(data stored in ACNUC7421 zone)

EMBL: AM946981.YBEHM

AM946981.YBEHM       Location/Qualifiers
FT   CDS             618386..619174
FT                   /transl_table=11
FT                   /gene="ybeHM"
FT                   /locus_tag="B21_00584"
FT                   /product="predicted protein ybeHM"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00584"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31101"
FT                   /protein_id="CAQ31101.1"
FT                   /translation="MLVAAGQFAVTSVWEKNAEICASLMAQAAENDVSLFVLPEALLAR
FT                   DDHDADLSVKSAQLLEGEFLGRLRRESKRNMMTTILTIHVPSTPGRAWNMLVALQAGNI
FT                   VARYAKLHLYDAFAIQESRRVDAGNEIAPLLEVEGMKVGLMTCYDLRFPELALAQALQG
FT                   AEILVLPAAWVRGPLKEHHWSTLLAARALDTTCYMVAAGECGNKNIGQSRIIDPFGVTI
FT                   AAASEMPALIMAEVTPERVRQVRAQLPVLNNRRFAPPQLL"
     MLVAAGQFAV TSVWEKNAEI CASLMAQAAE NDVSLFVLPE ALLARDDHDA DLSVKSAQLL        60
     EGEFLGRLRR ESKRNMMTTI LTIHVPSTPG RAWNMLVALQ AGNIVARYAK LHLYDAFAIQ       120
     ESRRVDAGNE IAPLLEVEGM KVGLMTCYDL RFPELALAQA LQGAEILVLP AAWVRGPLKE       180
     HHWSTLLAAR ALDTTCYMVA AGECGNKNIG QSRIIDPFGV TIAAASEMPA LIMAEVTPER       240
     VRQVRAQLPV LNNRRFAPPQ LL                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page