(data stored in ACNUC7421 zone)

EMBL: AM946981.YBFG

AM946981.YBFG        Location/Qualifiers
FT   CDS             complement(675815..676225)
FT                   /transl_table=11
FT                   /gene="ybfG"
FT                   /locus_tag="B21_00638"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00638"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31155"
FT                   /protein_id="CAQ31155.1"
FT                   /translation="MPRDPVSWTQRPEFAGVRALPIADDVAGGIFALNGGDLGEDTGCV
FT                   YYFAPDTLNWESLEVGYSEFLQWALSGDLDTFYENVRWQQWREDVIKLSATEAFTFYPF
FT                   LWVQSEEARTRKVISLTELWEMQYQMKETFTQ"
     MPRDPVSWTQ RPEFAGVRAL PIADDVAGGI FALNGGDLGE DTGCVYYFAP DTLNWESLEV        60
     GYSEFLQWAL SGDLDTFYEN VRWQQWREDV IKLSATEAFT FYPFLWVQSE EARTRKVISL       120
     TELWEMQYQM KETFTQ                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page