(data stored in ACNUC7421 zone)

EMBL: AM946981.YBGA

AM946981.YBGA        Location/Qualifiers
FT   CDS             697667..698176
FT                   /transl_table=11
FT                   /gene="ybgA"
FT                   /locus_tag="B21_00656"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00656"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31173"
FT                   /protein_id="CAQ31173.1"
FT                   /translation="MNQQRFDDSTLIRIFALHELHRLKEHGLTRGALLDYHSRYKLVFL
FT                   AHSQPEYRKLGPFVADIHQWQNLDDFYNQYYQRVIVLLSHPANPRDHTNVLMHVQGYFR
FT                   PHIDSTERQQLAALIDSYRRGEQPLLAPLMRIKHYMALYPDAWLSGQRYFELWPRVINL
FT                   RHSGVL"
     MNQQRFDDST LIRIFALHEL HRLKEHGLTR GALLDYHSRY KLVFLAHSQP EYRKLGPFVA        60
     DIHQWQNLDD FYNQYYQRVI VLLSHPANPR DHTNVLMHVQ GYFRPHIDST ERQQLAALID       120
     SYRRGEQPLL APLMRIKHYM ALYPDAWLSG QRYFELWPRV INLRHSGVL                   169
//

If you have problems or comments...

PBIL Back to PBIL home page