(data stored in ACNUC7421 zone)

EMBL: AM946981.YBGF

AM946981.YBGF        Location/Qualifiers
FT   CDS             738253..739044
FT                   /transl_table=11
FT                   /gene="ybgF"
FT                   /locus_tag="B21_00691"
FT                   /product="predicted periplasmic protein, subunit of The
FT                   Tol-Pal Cell Envelope Complex, Colicin S4 Transport System
FT                   and The Colicin A Import System"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00691"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31208"
FT                   /protein_id="CAQ31208.1"
FT                   /translation="MSSNFRHQLLSLSLLVGIAAPWAAFAQAPISSVGSGSVEDRVTQL
FT                   ERISNAHSQLLTQLQQQLSDNQSDIDSLRGQIQENQYQLNQVVERQKQILLQIDSLSSG
FT                   GAAAQSTSSDQSGAAASTTPTADAGTANAGAPVKSGDANTDYNAAIALVQDKSRQDDAM
FT                   VAFQNFIKNYPDSTYLPNANYWLGQLNYNKGKKDDAAYYFASVVKNYPKSPKAADAMFK
FT                   VGVIMQDKGDTAKAKAVYQQVISKYPGTDGAKQAQKRLNAM"
     MSSNFRHQLL SLSLLVGIAA PWAAFAQAPI SSVGSGSVED RVTQLERISN AHSQLLTQLQ        60
     QQLSDNQSDI DSLRGQIQEN QYQLNQVVER QKQILLQIDS LSSGGAAAQS TSSDQSGAAA       120
     STTPTADAGT ANAGAPVKSG DANTDYNAAI ALVQDKSRQD DAMVAFQNFI KNYPDSTYLP       180
     NANYWLGQLN YNKGKKDDAA YYFASVVKNY PKSPKAADAM FKVGVIMQDK GDTAKAKAVY       240
     QQVISKYPGT DGAKQAQKRL NAM                                               263
//

If you have problems or comments...

PBIL Back to PBIL home page