(data stored in ACNUC7421 zone)

EMBL: AM946981.YBGH

AM946981.YBGH        Location/Qualifiers
FT   CDS             complement(699633..701114)
FT                   /transl_table=11
FT                   /gene="ybgH"
FT                   /locus_tag="B21_00658"
FT                   /product="DtpD peptide POT Transporter"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00658"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31175"
FT                   /protein_id="CAQ31175.1"
FT                   /translation="MNKHASQPRAIYYVVALQIWEYFSFYGMRALLILYLTNQLKYNDT
FT                   HAYELFSAYCSLVYVTPILGGFLADKVLGNRMAVMLGALLMAIGHVVLGASEIHPSFLY
FT                   LSLAIIVCGYGLFKSNVSCLLGELYEPTDPRRDGGFSLMYAAGNVGSIIAPIACGYAQE
FT                   EYSWAMGFGLAAVGMIAGLVIFLCGNRHFTHTRGVNKKVLRATNFLLPNWGWLLVLLVA
FT                   TPALITVLFWKEWSVYALIVATIIGLGVLAKIYRKAENQKQRKELGLIVTLTFFSMLFW
FT                   AFAQQGGSSISLYIDRFVNRDMFGYTVPTAMFQSINAFAVMLCGVFLAWVVKESVAGNR
FT                   TVRIWGKFALGLGLMSAGFCILTLSARWSAMYGHSSLPLMVLGLAVMGFAELFIDPVAM
FT                   SQITRIEIPGVTGVLTGIYMLLSGAIANYLAGVIADQTSQASFDASGAINYSINAYIEV
FT                   FDQITWGALACVGVVLMIWLYQALKFRNRALALES"
     MNKHASQPRA IYYVVALQIW EYFSFYGMRA LLILYLTNQL KYNDTHAYEL FSAYCSLVYV        60
     TPILGGFLAD KVLGNRMAVM LGALLMAIGH VVLGASEIHP SFLYLSLAII VCGYGLFKSN       120
     VSCLLGELYE PTDPRRDGGF SLMYAAGNVG SIIAPIACGY AQEEYSWAMG FGLAAVGMIA       180
     GLVIFLCGNR HFTHTRGVNK KVLRATNFLL PNWGWLLVLL VATPALITVL FWKEWSVYAL       240
     IVATIIGLGV LAKIYRKAEN QKQRKELGLI VTLTFFSMLF WAFAQQGGSS ISLYIDRFVN       300
     RDMFGYTVPT AMFQSINAFA VMLCGVFLAW VVKESVAGNR TVRIWGKFAL GLGLMSAGFC       360
     ILTLSARWSA MYGHSSLPLM VLGLAVMGFA ELFIDPVAMS QITRIEIPGV TGVLTGIYML       420
     LSGAIANYLA GVIADQTSQA SFDASGAINY SINAYIEVFD QITWGALACV GVVLMIWLYQ       480
     ALKFRNRALA LES                                                          493
//

If you have problems or comments...

PBIL Back to PBIL home page