(data stored in ACNUC7421 zone)

EMBL: AM946981.YBHF

AM946981.YBHF        Location/Qualifiers
FT   CDS             complement(811231..812967)
FT                   /transl_table=11
FT                   /gene="ybhF"
FT                   /locus_tag="B21_00778"
FT                   /product="ybhF, subunit of YbhF/YbhR/YbhS ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00778"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31295"
FT                   /protein_id="CAQ31295.1"
FT                   /translation="MNDAVITLNGLEKRFPGMDKPAVAPLDCTIHAGYVTGLVGPDGAG
FT                   KTTLMRMLAGLLKPDSGSATVIGFDPIKNDGALHAVLGYMPQKFGLYEDLTVMENLNLY
FT                   ADLRSVTGEARKQTFARLLEFTSLGPFTRRLAGKLSGGMKQKLGLACTLVGEPKVLLLD
FT                   EPGVGVDPISRRELWQMVHELAGEGMLILWSTSYLDEAEQCRDVLLMNEGELLYQGEPK
FT                   ALTQTMAGRSFLMTSPHEGNRKLLQRALKLPQVSDGMIQGKSVRLILKKEATPDDIRHA
FT                   DGMPEININETTPRFEDAFIDLLGGAGTSESPLGAILHTVEGTPGETVIEAKELTKKFG
FT                   DFAATDHVNFAVKRGEIFGLLGPNGAGKSTTFKMMCGLLVPTSGQALVLGMDLKESSGK
FT                   ARQHLGYMAQKFSLYGNLTVEQNLRFFSGVYGLRGRAQNEKISRMSEAFGLKSIASHAT
FT                   DELPLGFKQRLALACSLMHEPDILFLDEPTSGVDPLTRREFWLHINSMVEKGVTVMVTT
FT                   HFMDEAEYCDRIGLVYRGKLIASGTPDDLKAQSANDEQPDPTMEQAFIQLIHDWDKEHS
FT                   NE"
     MNDAVITLNG LEKRFPGMDK PAVAPLDCTI HAGYVTGLVG PDGAGKTTLM RMLAGLLKPD        60
     SGSATVIGFD PIKNDGALHA VLGYMPQKFG LYEDLTVMEN LNLYADLRSV TGEARKQTFA       120
     RLLEFTSLGP FTRRLAGKLS GGMKQKLGLA CTLVGEPKVL LLDEPGVGVD PISRRELWQM       180
     VHELAGEGML ILWSTSYLDE AEQCRDVLLM NEGELLYQGE PKALTQTMAG RSFLMTSPHE       240
     GNRKLLQRAL KLPQVSDGMI QGKSVRLILK KEATPDDIRH ADGMPEININ ETTPRFEDAF       300
     IDLLGGAGTS ESPLGAILHT VEGTPGETVI EAKELTKKFG DFAATDHVNF AVKRGEIFGL       360
     LGPNGAGKST TFKMMCGLLV PTSGQALVLG MDLKESSGKA RQHLGYMAQK FSLYGNLTVE       420
     QNLRFFSGVY GLRGRAQNEK ISRMSEAFGL KSIASHATDE LPLGFKQRLA LACSLMHEPD       480
     ILFLDEPTSG VDPLTRREFW LHINSMVEKG VTVMVTTHFM DEAEYCDRIG LVYRGKLIAS       540
     GTPDDLKAQS ANDEQPDPTM EQAFIQLIHD WDKEHSNE                               578
//

If you have problems or comments...

PBIL Back to PBIL home page