(data stored in SCRATCH zone)

EMBL: AM946981.YBHL

AM946981.YBHL        Location/Qualifiers
FT   CDS             803870..804574
FT                   /transl_table=11
FT                   /gene="ybhL"
FT                   /locus_tag="B21_00770"
FT                   /product="predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00770"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31287"
FT                   /protein_id="CAQ31287.1"
FT                   /translation="MDRFPRSDSIVQPRAGLQTYMAQVYGWMTVGLLLTAFVAWYAANS
FT                   AAVMELLFTNRVFLIGLIIAQLALVIVLSAMIQKLSAGVTTMLFMLYSALTGLTLSSIF
FT                   IVYTAASIASTFVVTAGMFGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKS
FT                   EALMWAVTYIGVIVFVGLTAYDTQKLKNMGEQIDTRDTSNLRKYSILGALTLYLDFINL
FT                   FLMLLRIFGNRR"
     MDRFPRSDSI VQPRAGLQTY MAQVYGWMTV GLLLTAFVAW YAANSAAVME LLFTNRVFLI        60
     GLIIAQLALV IVLSAMIQKL SAGVTTMLFM LYSALTGLTL SSIFIVYTAA SIASTFVVTA       120
     GMFGAMSLYG YTTKRDLSGF GNMLFMALIG IVLASLVNFW LKSEALMWAV TYIGVIVFVG       180
     LTAYDTQKLK NMGEQIDTRD TSNLRKYSIL GALTLYLDFI NLFLMLLRIF GNRR             234
//

If you have problems or comments...

PBIL Back to PBIL home page