(data stored in SCRATCH zone)

EMBL: AM946981.YBHN

AM946981.YBHN        Location/Qualifiers
FT   CDS             complement(805528..806484)
FT                   /transl_table=11
FT                   /gene="ybhN"
FT                   /locus_tag="B21_00772"
FT                   /product="conserved inner membrane protein; predicted
FT                   DNA-binding transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00772"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31289"
FT                   /protein_id="CAQ31289.1"
FT                   /translation="MSKSHPRWRLAKKILTWLLFIAVIVLLVVYAKKVDWEEVWKVIRD
FT                   YNRVALLSAVGLVVVSYLIYGCYDLLARFYCGHKLAKRQVMLVSFICYAFNLTLSTWVG
FT                   GIGMRYRLYSRLGLPGSTITRIFSLSITTNWLGYILLAGIIFTAGVVELPDHWYVDQTT
FT                   LRILGIGLLTIIAVYLWFCAFAKHRHMTIKGQKLVLPSWKFALAQMLISSVNWMVMGAI
FT                   IWLLLGQSVNYFFVLGVLLVSSIAGVIVHIPAGIGVLEAVFIALLAGEHTSKGSIIAAL
FT                   LAYRVLYYFIPLLLALICYLLLESQAKKLRAKNEAAM"
     MSKSHPRWRL AKKILTWLLF IAVIVLLVVY AKKVDWEEVW KVIRDYNRVA LLSAVGLVVV        60
     SYLIYGCYDL LARFYCGHKL AKRQVMLVSF ICYAFNLTLS TWVGGIGMRY RLYSRLGLPG       120
     STITRIFSLS ITTNWLGYIL LAGIIFTAGV VELPDHWYVD QTTLRILGIG LLTIIAVYLW       180
     FCAFAKHRHM TIKGQKLVLP SWKFALAQML ISSVNWMVMG AIIWLLLGQS VNYFFVLGVL       240
     LVSSIAGVIV HIPAGIGVLE AVFIALLAGE HTSKGSIIAA LLAYRVLYYF IPLLLALICY       300
     LLLESQAKKL RAKNEAAM                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page