(data stored in SCRATCH zone)

EMBL: AM946981.YBHQ

AM946981.YBHQ        Location/Qualifiers
FT   CDS             808616..809026
FT                   /transl_table=11
FT                   /gene="ybhQ"
FT                   /locus_tag="B21_00775"
FT                   /product="predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00775"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31292"
FT                   /protein_id="CAQ31292.1"
FT                   /translation="MKWQQRVRVATGLSCWQIMLHLLVVALLVVGWMSKTLVHVGVGLC
FT                   ALYCVTVVMMLVFQRHPEQRWREVADVLEELTTTWYFGAALIVLWLLSRVLENNFLLAI
FT                   AGLAILAGPAVVSLLAKDKKLHHLTSKHRVRR"
     MKWQQRVRVA TGLSCWQIML HLLVVALLVV GWMSKTLVHV GVGLCALYCV TVVMMLVFQR        60
     HPEQRWREVA DVLEELTTTW YFGAALIVLW LLSRVLENNF LLAIAGLAIL AGPAVVSLLA       120
     KDKKLHHLTS KHRVRR                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page