(data stored in ACNUC7421 zone)

EMBL: AM946981.YBHR

AM946981.YBHR        Location/Qualifiers
FT   CDS             complement(808988..810094)
FT                   /transl_table=11
FT                   /gene="ybhR"
FT                   /locus_tag="B21_00776"
FT                   /product="ybhR, subunit of YbhF/YbhR/YbhS ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00776"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31293"
FT                   /protein_id="CAQ31293.1"
FT                   /translation="MFHRLWTLIRKELQSLLREPQTRAILILPVLIQVILFPFAATLEV
FT                   TNATIAIYDEDNGEHSVELTQRFARASAFTHVLLLKSPQEIRPTIDTQKALLLVRFPAD
FT                   FSRKLDTFQTAPLQLILDGRNSNSAQIAANYLQQIVKNYQQELLEGKPKPNNSELVVRN
FT                   WYNPNLDYKWFVVPSLIAMITTIGVMIVTSLSVAREREQGTLDQLLVSPLTTWQIFIGK
FT                   AVPALIVATFQATIVLAIGIWAYQIPFAGSLALFYFTMVIYGLSLVGFGLLISSLCSTQ
FT                   QQAFIGVFVFMMPAILLSGYVSPVENMPVWLQNLTWINPIRHFTDITKQIYLKDASLDI
FT                   VWNSLWPLLVITATTGSAAYAMFRRKVM"
     MFHRLWTLIR KELQSLLREP QTRAILILPV LIQVILFPFA ATLEVTNATI AIYDEDNGEH        60
     SVELTQRFAR ASAFTHVLLL KSPQEIRPTI DTQKALLLVR FPADFSRKLD TFQTAPLQLI       120
     LDGRNSNSAQ IAANYLQQIV KNYQQELLEG KPKPNNSELV VRNWYNPNLD YKWFVVPSLI       180
     AMITTIGVMI VTSLSVARER EQGTLDQLLV SPLTTWQIFI GKAVPALIVA TFQATIVLAI       240
     GIWAYQIPFA GSLALFYFTM VIYGLSLVGF GLLISSLCST QQQAFIGVFV FMMPAILLSG       300
     YVSPVENMPV WLQNLTWINP IRHFTDITKQ IYLKDASLDI VWNSLWPLLV ITATTGSAAY       360
     AMFRRKVM                                                                368
//

If you have problems or comments...

PBIL Back to PBIL home page