(data stored in ACNUC7421 zone)

EMBL: AM946981.YBHU

AM946981.YBHU        Location/Qualifiers
FT   CDS             complement(797101..797238)
FT                   /transl_table=11
FT                   /gene="ybhU"
FT                   /locus_tag="B21_04298"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_04298"
FT                   /db_xref="EnsemblGenomes-Tr:CBY77817"
FT                   /protein_id="CBY77817.1"
FT                   /translation="MHLSNQLKNKRYFFEPSLTPIRVQAAYSLACLVFSNSNTHGYPQE
FT                   "
     MHLSNQLKNK RYFFEPSLTP IRVQAAYSLA CLVFSNSNTH GYPQE                        45
//

If you have problems or comments...

PBIL Back to PBIL home page