(data stored in ACNUC7421 zone)

EMBL: AM946981.YBIA

AM946981.YBIA        Location/Qualifiers
FT   CDS             complement(816454..816936)
FT                   /transl_table=11
FT                   /gene="ybiA"
FT                   /locus_tag="B21_00782"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00782"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31299"
FT                   /protein_id="CAQ31299.1"
FT                   /translation="MPVRAQRIQHVMQDTIINFYSTSDDYGDFSNFAAWPIKVDGKTWP
FT                   TSEHYFQAQKFLDEKYREEIRRVSSPMVAARMGRDRSKPLRKNWESVKEQVMRKALRAK
FT                   FEQHAELRALLLATAPAKLVEHTENDAYWGDGGHGKGKNRLGYLLMELREQLAIEK"
     MPVRAQRIQH VMQDTIINFY STSDDYGDFS NFAAWPIKVD GKTWPTSEHY FQAQKFLDEK        60
     YREEIRRVSS PMVAARMGRD RSKPLRKNWE SVKEQVMRKA LRAKFEQHAE LRALLLATAP       120
     AKLVEHTEND AYWGDGGHGK GKNRLGYLLM ELREQLAIEK                             160
//

If you have problems or comments...

PBIL Back to PBIL home page