(data stored in ACNUC7421 zone)

EMBL: AM946981.YBIJ

AM946981.YBIJ        Location/Qualifiers
FT   CDS             complement(821651..821911)
FT                   /transl_table=11
FT                   /gene="ybiJ"
FT                   /locus_tag="B21_00786"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00786"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31303"
FT                   /protein_id="CAQ31303.1"
FT                   /translation="MKTINTVVAAMALSTLSFGVFAAEPVTASQAQNMNKIGVVSADGA
FT                   STLDALEAKLAEKAAAAGASGYSITSATNNNKLSGTAVIYK"
     MKTINTVVAA MALSTLSFGV FAAEPVTASQ AQNMNKIGVV SADGASTLDA LEAKLAEKAA        60
     AAGASGYSIT SATNNNKLSG TAVIYK                                             86
//

If you have problems or comments...

PBIL Back to PBIL home page