(data stored in ACNUC7421 zone)

EMBL: AM946981.YBIX

AM946981.YBIX        Location/Qualifiers
FT   CDS             complement(822516..823193)
FT                   /transl_table=11
FT                   /gene="ybiX"
FT                   /locus_tag="B21_00788"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00788"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31305"
FT                   /protein_id="CAQ31305.1"
FT                   /translation="MMYHIPGVLSPQDVARFREQLEQAEWVDGRVTTGAQGAQVKNNQQ
FT                   VDTRSTLYAALQNEVLNAVNQHALFFAAALPRTLSTPLFNRYQNNETYGFHVDGAVRSH
FT                   PQNGWMRTDLSATLFLSDPQSYDGGELVVNDTFGQHRVKLPAGDLVLYPSSSLHCVTPV
FT                   TRGVRVASFMWIQSMIRDDKKRAMLFELDNNIQSLKSRYGESEEILSLLNLYHNLLREW
FT                   SEI"
     MMYHIPGVLS PQDVARFREQ LEQAEWVDGR VTTGAQGAQV KNNQQVDTRS TLYAALQNEV        60
     LNAVNQHALF FAAALPRTLS TPLFNRYQNN ETYGFHVDGA VRSHPQNGWM RTDLSATLFL       120
     SDPQSYDGGE LVVNDTFGQH RVKLPAGDLV LYPSSSLHCV TPVTRGVRVA SFMWIQSMIR       180
     DDKKRAMLFE LDNNIQSLKS RYGESEEILS LLNLYHNLLR EWSEI                       225
//

If you have problems or comments...

PBIL Back to PBIL home page