(data stored in ACNUC7421 zone)

EMBL: AM946981.YBIY

AM946981.YBIY        Location/Qualifiers
FT   CDS             complement(846525..847451)
FT                   /transl_table=11
FT                   /gene="ybiY"
FT                   /locus_tag="B21_00808"
FT                   /product="predicted pyruvate formate lyase activating
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00808"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31325"
FT                   /protein_id="CAQ31325.1"
FT                   /translation="MFERNREATMIFNIQRYSTHDGPGIRTVVFLKGCSLGCRWCQNPE
FT                   SRARTQDLLYDARLCLEGCELCAKAAPEVIERALNGLLIHREKLTPEHLTALTDCCPTQ
FT                   ALTVCGEVKSVEEIMATVLRDKPFYDRSGGGLTLSGGEPFMQPEMATALLQASHEAGIH
FT                   TAVETCLHVPWKYIAPSLPYIDLFLADLKHVADAPFKQWTDGNAARVLDNLKKLAAAGK
FT                   KIIIRVPLIQGFNADETSVKAITDFAADELHVGEIHFLPYHTLGINKYHLLNLPYDAPE
FT                   KPLDAPELLDFAQQYACQKGLTATLRG"
     MFERNREATM IFNIQRYSTH DGPGIRTVVF LKGCSLGCRW CQNPESRART QDLLYDARLC        60
     LEGCELCAKA APEVIERALN GLLIHREKLT PEHLTALTDC CPTQALTVCG EVKSVEEIMA       120
     TVLRDKPFYD RSGGGLTLSG GEPFMQPEMA TALLQASHEA GIHTAVETCL HVPWKYIAPS       180
     LPYIDLFLAD LKHVADAPFK QWTDGNAARV LDNLKKLAAA GKKIIIRVPL IQGFNADETS       240
     VKAITDFAAD ELHVGEIHFL PYHTLGINKY HLLNLPYDAP EKPLDAPELL DFAQQYACQK       300
     GLTATLRG                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page