(data stored in ACNUC7421 zone)

EMBL: AM946981.YBJM

AM946981.YBJM        Location/Qualifiers
FT   CDS             894787..895164
FT                   /transl_table=11
FT                   /gene="ybjM"
FT                   /locus_tag="B21_00859"
FT                   /product="predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00859"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31376"
FT                   /protein_id="CAQ31376.1"
FT                   /translation="MKHKQRWAGAICCFVLFIVVCLFLATHMKGAFRAAGHPEIGLLFF
FT                   ILPGAVASFFSQRREVLKPLFGAMLAAPCSMLIMRLFFSPTRSFWQELAWLLSAVFWCA
FT                   LGALCFLFISSLFKPQHRKNQ"
     MKHKQRWAGA ICCFVLFIVV CLFLATHMKG AFRAAGHPEI GLLFFILPGA VASFFSQRRE        60
     VLKPLFGAML AAPCSMLIMR LFFSPTRSFW QELAWLLSAV FWCALGALCF LFISSLFKPQ       120
     HRKNQ                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page