(data stored in ACNUC7421 zone)

EMBL: AM946981.YBJQ

AM946981.YBJQ        Location/Qualifiers
FT   CDS             909291..909614
FT                   /transl_table=11
FT                   /gene="ybjQ"
FT                   /locus_tag="B21_00877"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00877"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31394"
FT                   /protein_id="CAQ31394.1"
FT                   /translation="MQFSTTPTLEGQTIVEYCGVVTGEAILGANIFRDFFAGIRDIVGG
FT                   RSGAYEKELRKAREIAFEELGSQARALGADAVVGIDIDYETVGQNGSMLMVSVSGTAVK
FT                   TRR"
     MQFSTTPTLE GQTIVEYCGV VTGEAILGAN IFRDFFAGIR DIVGGRSGAY EKELRKAREI        60
     AFEELGSQAR ALGADAVVGI DIDYETVGQN GSMLMVSVSG TAVKTRR                     107
//

If you have problems or comments...

PBIL Back to PBIL home page