(data stored in ACNUC7421 zone)

EMBL: AM946981.YBJT

AM946981.YBJT        Location/Qualifiers
FT   CDS             complement(911550..912980)
FT                   /transl_table=11
FT                   /gene="ybjT"
FT                   /locus_tag="B21_00880"
FT                   /product="conserved protein with NAD(P)-binding
FT                   Rossmann-fold domain"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00880"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31397"
FT                   /protein_id="CAQ31397.1"
FT                   /translation="MPQRILVLGASGYIGQHLVRTLSRQGHQILAAARHVDRLAKLQLA
FT                   NVSCHKVDLSWPDNLPALLQDIDTVYFLVHSMGEGGDFIAQERQVALNVRDALREVPVK
FT                   QLIFLSSLQAPPHEQSDHLRARQATADILREANVPVTELRAGIIVGAGSAAFEVMRDMV
FT                   YNLPVLTPPRWVRSRTTPIALENLLHYLVALLDHPASEHRIFEAAGPEVLSYQQQFEHF
FT                   MAVSGKRRWLIPIPLPTRWISVWFLNVITSVPPTTARALIQGLKHDLLADDTALRALIP
FT                   QRLIAFDDAVRSTLKEEEKLVNSSDWGYDAQAFARWRPEYGYFAKQAGFTVKTSASLAA
FT                   LWQVVNQIGGKERYFFGNILWQTRALMDRAIGHKLAKGRPEREYLQTGDAVDSWKVIVV
FT                   EPEKQLTLLFGMKAPGLGRLCFSLEDKGDYRTIDVRAFWHPHGMPGLFYWLLMIPAHLF
FT                   IFRGMAKQIARLAEQSTD"
     MPQRILVLGA SGYIGQHLVR TLSRQGHQIL AAARHVDRLA KLQLANVSCH KVDLSWPDNL        60
     PALLQDIDTV YFLVHSMGEG GDFIAQERQV ALNVRDALRE VPVKQLIFLS SLQAPPHEQS       120
     DHLRARQATA DILREANVPV TELRAGIIVG AGSAAFEVMR DMVYNLPVLT PPRWVRSRTT       180
     PIALENLLHY LVALLDHPAS EHRIFEAAGP EVLSYQQQFE HFMAVSGKRR WLIPIPLPTR       240
     WISVWFLNVI TSVPPTTARA LIQGLKHDLL ADDTALRALI PQRLIAFDDA VRSTLKEEEK       300
     LVNSSDWGYD AQAFARWRPE YGYFAKQAGF TVKTSASLAA LWQVVNQIGG KERYFFGNIL       360
     WQTRALMDRA IGHKLAKGRP EREYLQTGDA VDSWKVIVVE PEKQLTLLFG MKAPGLGRLC       420
     FSLEDKGDYR TIDVRAFWHP HGMPGLFYWL LMIPAHLFIF RGMAKQIARL AEQSTD           476
//

If you have problems or comments...

PBIL Back to PBIL home page