(data stored in ACNUC7421 zone)

EMBL: AM946981.YBL15

AM946981.YBL15       Location/Qualifiers
FT   CDS             complement(535264..535542)
FT                   /transl_table=11
FT                   /gene="ybl15"
FT                   /locus_tag="B21_00493"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00493"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31010"
FT                   /protein_id="CAQ31010.2"
FT                   /translation="MFRIILPNTWYVDHHGTPCKILRSTHNKVHYIRKGRTCIASMFRF
FT                   NHDFEPVNKADADRIAEEIETAEHIKKLRDMRSKSRGNHGIIQPHTR"
     MFRIILPNTW YVDHHGTPCK ILRSTHNKVH YIRKGRTCIA SMFRFNHDFE PVNKADADRI        60
     AEEIETAEHI KKLRDMRSKS RGNHGIIQPH TR                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page