(data stored in ACNUC7421 zone)

EMBL: AM946981.YKGM

AM946981.YKGM        Location/Qualifiers
FT   CDS             complement(282691..282954)
FT                   /transl_table=11
FT                   /gene="ykgM"
FT                   /locus_tag="B21_00259"
FT                   /product="predicted ribosomal protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00259"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ30776"
FT                   /protein_id="CAQ30776.1"
FT                   /translation="MKPNIHPEYRTVVFHDTSVDEYFKIGSTIKTDREIELDGVTYPYV
FT                   TIDVSSKSHPFYTGKLRTVASEGNVARFTQRFGRFVSTKKGA"
     MKPNIHPEYR TVVFHDTSVD EYFKIGSTIK TDREIELDGV TYPYVTIDVS SKSHPFYTGK        60
     LRTVASEGNV ARFTQRFGRF VSTKKGA                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page