(data stored in ACNUC7421 zone)

EMBL: AM946981.YLBF

AM946981.YLBF        Location/Qualifiers
FT   CDS             518766..519581
FT                   /transl_table=11
FT                   /gene="ylbF"
FT                   /locus_tag="B21_00475"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00475"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ30992"
FT                   /protein_id="CAQ30992.1"
FT                   /translation="MTIIHPLLASRSAPNYRQSWRLAGVWRRAINLMTESGELLTLHRQ
FT                   GSGFGPGGWVLRRAQFDALCGGLCGNERPQVVAQGIRLGRFTVKQPQRYCLLRITPPAH
FT                   PQPLAAAWMQRAEETGLFGPLALAASDPLTAELRQFRHCFQAALNGVKTDWRHWLGKGP
FT                   GLTPSHDDTLSGMLLAAWYYGALDARSGRPFFACSDNLQLVTTAVSVSYLRYAAQGYFA
FT                   SPLLHFVHALSCPKRTAVAIDSLLALGHTSGADTLLGFWLGQQLLQGKP"
     MTIIHPLLAS RSAPNYRQSW RLAGVWRRAI NLMTESGELL TLHRQGSGFG PGGWVLRRAQ        60
     FDALCGGLCG NERPQVVAQG IRLGRFTVKQ PQRYCLLRIT PPAHPQPLAA AWMQRAEETG       120
     LFGPLALAAS DPLTAELRQF RHCFQAALNG VKTDWRHWLG KGPGLTPSHD DTLSGMLLAA       180
     WYYGALDARS GRPFFACSDN LQLVTTAVSV SYLRYAAQGY FASPLLHFVH ALSCPKRTAV       240
     AIDSLLALGH TSGADTLLGF WLGQQLLQGK P                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page