(data stored in ACNUC7421 zone)

EMBL: AM946981.YLCI

AM946981.YLCI        Location/Qualifiers
FT   CDS             complement(547422..547616)
FT                   /transl_table=11
FT                   /gene="ylcI"
FT                   /locus_tag="B21_04273"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:B21_04273"
FT                   /db_xref="EnsemblGenomes-Tr:CBY77805"
FT                   /protein_id="CBY77805.1"
FT                   /translation="MSTKNRTRRTTTRNIRFPNQMIEQINIALEQKGSGNFSAWVIEAC
FT                   RRRLTSEKRAYTSIQSDDE"
     MSTKNRTRRT TTRNIRFPNQ MIEQINIALE QKGSGNFSAW VIEACRRRLT SEKRAYTSIQ        60
     SDDE                                                                     64
//

If you have problems or comments...

PBIL Back to PBIL home page