(data stored in ACNUC1104 zone)

EMBL: AP008957.ACCD

AP008957.ACCD        Location/Qualifiers
FT   CDS             258493..260034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accD"
FT                   /gene_synonym="accD4"
FT                   /locus_tag="RER_02220"
FT                   /product="probable acyl-CoA carboxylase beta chain"
FT                   /EC_number="6.4.1.-"
FT                   /note="protein synonym:carboxyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02220"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30930"
FT                   /db_xref="GOA:C0ZLV3"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLV3"
FT                   /protein_id="BAH30930.1"
FT                   /translation="MTTTTAEKLAELREKLEKAKEPGSARAIAKRDAAGHSTPRQRIDM
FT                   LLDPGSFVEVGALVKMAGEDNPYSDGVMTGHGTVDGRPVAVFAHDQTVFGGAAGEMFGR
FT                   KVAAVNDFALKVGCPVVGINDSGGARIQDAVSSLAWYANMGSRQEPLSGVCPQISVILG
FT                   KCAGGAVYAPINTDVVVATEESYMFVTGPDVIKSVTGEEVSLEDLGGARKQAEYGNIHH
FT                   VAPDEKAAFDWVREYLSFMPSSCTEKAPLINPGLEPEITESDLELNAFMPDADNAGYDM
FT                   HDIILRIFDDGTFHEIGAQVAHNVITGFSRVDGLPVGVVANQPTYLSGALDADSSDKAA
FT                   HFVRLCDAFSIPLVFVVDTPGFLPGVDQEKVGVIKRGGRFLFAYIEATVPKVTVVVRKA
FT                   YGGGYAVMGCKQLGADINLAWPTARIAVMGAEGAVNIMGRRQLAEAGENAPAVRAQLIN
FT                   FYNEFVATPYIAAERGYIDAVIEPSQTRLEIRKALKLLKDKTIFKNPRKHNLMPL"
     MTTTTAEKLA ELREKLEKAK EPGSARAIAK RDAAGHSTPR QRIDMLLDPG SFVEVGALVK        60
     MAGEDNPYSD GVMTGHGTVD GRPVAVFAHD QTVFGGAAGE MFGRKVAAVN DFALKVGCPV       120
     VGINDSGGAR IQDAVSSLAW YANMGSRQEP LSGVCPQISV ILGKCAGGAV YAPINTDVVV       180
     ATEESYMFVT GPDVIKSVTG EEVSLEDLGG ARKQAEYGNI HHVAPDEKAA FDWVREYLSF       240
     MPSSCTEKAP LINPGLEPEI TESDLELNAF MPDADNAGYD MHDIILRIFD DGTFHEIGAQ       300
     VAHNVITGFS RVDGLPVGVV ANQPTYLSGA LDADSSDKAA HFVRLCDAFS IPLVFVVDTP       360
     GFLPGVDQEK VGVIKRGGRF LFAYIEATVP KVTVVVRKAY GGGYAVMGCK QLGADINLAW       420
     PTARIAVMGA EGAVNIMGRR QLAEAGENAP AVRAQLINFY NEFVATPYIA AERGYIDAVI       480
     EPSQTRLEIR KALKLLKDKT IFKNPRKHNL MPL                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page