(data stored in ACNUC1104 zone)

EMBL: AP008957.ACOA/ACOB

AP008957.ACOA/ACOB   Location/Qualifiers
FT   CDS             492151..494133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acoA/acoB"
FT                   /locus_tag="RER_04420"
FT                   /product="putative acetoin dehydrogenase E1 component"
FT                   /EC_number="1.1.1.-"
FT                   /note="protein synonym:acetoin--2,6-
FT                   dichlorophenolindophenol oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04420"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31150"
FT                   /db_xref="GOA:C0ZN98"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN98"
FT                   /protein_id="BAH31150.1"
FT                   /translation="MFRLVNGEEVLCAYEKMLLIRVMEERISALYKGDIIPGFVHTSIG
FT                   QEACAVGALTHARVSDVITSTHRGHGHVLAKGLEPDRMMAELMGKVTGANNGRGGSMHV
FT                   ADPRLGIFGANGIVGAGLPIAVGAAFAAKDRGEGDLVVAFFGDGAIATGAFHEAMNLAA
FT                   LWKLPIIFLCENNGFSEFSSTVDQHPVPISARAAGYGMESITLAGNDVEAVADGIRPVY
FT                   AQVRGGSGPVFVEVTTLRVHGHYEGDPQVYRDKDEMTRDILAADPLTVTRGRLRERGIG
FT                   DDVLDLVDKRVRAVVDEAERFARASPQPEASSVMEYIYSPRRVYPPGHLDVSVDAGGAA
FT                   VSQSKIIKAALDDSLAADPDVFLAGIDVAGGNVFGLTRGLAAEYPGRVLDTPISESAIM
FT                   GLAVGSAMAGRRPVVELMYLDFLGVCLDQLMNQAAKLRFMTGGAVSLPLVVRTQFGSGR
FT                   SSGGQHSQSLEALLAHIPGLTVLMPSSGADAYGLLRAAIEDDNPVMFIEHRLLYEKKSS
FT                   LPSKDFRVPIGKAAVTRPGSDVTIVSWSRMAMHALVAAQTLTEEGIDAEVIDLRTIAPL
FT                   DRETILESFGRTNRMVVAQEAVVDFGVGAEIAAMAVDSGFYSLDAPVVRVGARYAPAPY
FT                   APVLEREWEVGPDDIVAAVRRVMSC"
     MFRLVNGEEV LCAYEKMLLI RVMEERISAL YKGDIIPGFV HTSIGQEACA VGALTHARVS        60
     DVITSTHRGH GHVLAKGLEP DRMMAELMGK VTGANNGRGG SMHVADPRLG IFGANGIVGA       120
     GLPIAVGAAF AAKDRGEGDL VVAFFGDGAI ATGAFHEAMN LAALWKLPII FLCENNGFSE       180
     FSSTVDQHPV PISARAAGYG MESITLAGND VEAVADGIRP VYAQVRGGSG PVFVEVTTLR       240
     VHGHYEGDPQ VYRDKDEMTR DILAADPLTV TRGRLRERGI GDDVLDLVDK RVRAVVDEAE       300
     RFARASPQPE ASSVMEYIYS PRRVYPPGHL DVSVDAGGAA VSQSKIIKAA LDDSLAADPD       360
     VFLAGIDVAG GNVFGLTRGL AAEYPGRVLD TPISESAIMG LAVGSAMAGR RPVVELMYLD       420
     FLGVCLDQLM NQAAKLRFMT GGAVSLPLVV RTQFGSGRSS GGQHSQSLEA LLAHIPGLTV       480
     LMPSSGADAY GLLRAAIEDD NPVMFIEHRL LYEKKSSLPS KDFRVPIGKA AVTRPGSDVT       540
     IVSWSRMAMH ALVAAQTLTE EGIDAEVIDL RTIAPLDRET ILESFGRTNR MVVAQEAVVD       600
     FGVGAEIAAM AVDSGFYSLD APVVRVGARY APAPYAPVLE REWEVGPDDI VAAVRRVMSC       660
//

If you have problems or comments...

PBIL Back to PBIL home page