(data stored in ACNUC1104 zone)

EMBL: AP008957.AMIS

AP008957.AMIS        Location/Qualifiers
FT   CDS             complement(544982..545602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amiS"
FT                   /locus_tag="RER_04930"
FT                   /product="putative amidase substrates transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04930"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31201"
FT                   /db_xref="GOA:C0ZNE9"
FT                   /db_xref="InterPro:IPR003211"
FT                   /db_xref="InterPro:IPR038523"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNE9"
FT                   /protein_id="BAH31201.1"
FT                   /translation="MGSVGLLYVGAVLFVNGLMLLGTVPVRSASVLNLFVGALQCVVPT
FT                   VLLIQAQGDSSAVLAASGLYLFGFTYLYVGISNLAGFEPEGIGWFSLFVACAALVYSFL
FT                   SFTVSNDPVFGVIWLAWAALWTLFFLVLGLGRENLSRFTGWAAVLLSQPTCTVPAFLIL
FT                   TDNFHTTPAVAAGWAGALLVLLGLAKILAAPKAAVPQTHPVFN"
     MGSVGLLYVG AVLFVNGLML LGTVPVRSAS VLNLFVGALQ CVVPTVLLIQ AQGDSSAVLA        60
     ASGLYLFGFT YLYVGISNLA GFEPEGIGWF SLFVACAALV YSFLSFTVSN DPVFGVIWLA       120
     WAALWTLFFL VLGLGRENLS RFTGWAAVLL SQPTCTVPAF LILTDNFHTT PAVAAGWAGA       180
     LLVLLGLAKI LAAPKAAVPQ THPVFN                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page