(data stored in ACNUC1104 zone)

EMBL: AP008957.CFA

AP008957.CFA         Location/Qualifiers
FT   CDS             complement(433085..434386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cfa"
FT                   /locus_tag="RER_03830"
FT                   /product="putative cyclopropane fatty acid synthase"
FT                   /EC_number="2.1.1.79"
FT                   /note="protein synonym:cyclopropane-fatty-acyl-
FT                   phospholipid synthase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03830"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31091"
FT                   /db_xref="GOA:C0ZN39"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN39"
FT                   /protein_id="BAH31091.1"
FT                   /translation="MTTFKDSKSQDKLSIAEILETLSDGMLPLRFTAYDGSTAGPEDAD
FT                   YGLHLKSTRGTTYLATAPGDLGMARAYVSGDLEAEGVHPGDPYEILRIMGDELHLKRPS
FT                   ALTLASITRSLGWDLLRPIAPPPQEHLPRWRRVAEGLRHSKTRDAEVIHHHYDVSNTFY
FT                   EYVLGPSMTYTCAAYDNAEQTLEEAQENKYRLVFEKLGLQKGDRLLDIGCGWGSMVRYA
FT                   ARRGVKVIGVTLSREQADWAQKAIEDEGLADLAQVRFSDYRDVAETGFDAVSSIGLTEH
FT                   IGVGNYPAYFEFLKGKLREGGRLLNHCITRPDNRSSAKAGGFIDRYVFPDGELTGSGRI
FT                   ISEIQNVGLEVRHEENLREHYALTLAGWCQNLVDNWDACVAEVGEGTARVWGLYMAGSR
FT                   LGFERNVVQLHQVLAVKLGPKGEAHVPLRPWWKA"
     MTTFKDSKSQ DKLSIAEILE TLSDGMLPLR FTAYDGSTAG PEDADYGLHL KSTRGTTYLA        60
     TAPGDLGMAR AYVSGDLEAE GVHPGDPYEI LRIMGDELHL KRPSALTLAS ITRSLGWDLL       120
     RPIAPPPQEH LPRWRRVAEG LRHSKTRDAE VIHHHYDVSN TFYEYVLGPS MTYTCAAYDN       180
     AEQTLEEAQE NKYRLVFEKL GLQKGDRLLD IGCGWGSMVR YAARRGVKVI GVTLSREQAD       240
     WAQKAIEDEG LADLAQVRFS DYRDVAETGF DAVSSIGLTE HIGVGNYPAY FEFLKGKLRE       300
     GGRLLNHCIT RPDNRSSAKA GGFIDRYVFP DGELTGSGRI ISEIQNVGLE VRHEENLREH       360
     YALTLAGWCQ NLVDNWDACV AEVGEGTARV WGLYMAGSRL GFERNVVQLH QVLAVKLGPK       420
     GEAHVPLRPW WKA                                                          433
//

If you have problems or comments...

PBIL Back to PBIL home page