(data stored in ACNUC1104 zone)

EMBL: AP008957.CYSD

AP008957.CYSD        Location/Qualifiers
FT   CDS             complement(149535..150449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysD"
FT                   /locus_tag="RER_01270"
FT                   /product="sulfate adenylyltransferase subunit 2"
FT                   /EC_number="2.7.7.4"
FT                   /note="protein synonym:ATP sulfurylase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01270"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30835"
FT                   /db_xref="GOA:C0ZLK8"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR011784"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLK8"
FT                   /protein_id="BAH30835.1"
FT                   /translation="MSTVTDVVDELRVLESEAVHIIREVVAELERPVLLFSAGKDSIVL
FT                   LRLAEKAFRPSPLPFPVLHVDTGHNFEEVIEFRDRRIKEGGHTLLVASVQDSIDQGRVQ
FT                   ESTETSGSRNRLQTRTLLDALEGGRFDAAFGGARRDEERARAKERVLSFRDEFGQWDPR
FT                   AQRAEPWSLYNGRIRRGESVRVFPLSNWTELDIWRYIAQEELELPPIYFAHERRVFERD
FT                   GMLLAASEFSTDAENAAATTEWVRYRTVGDLTITGAVRSHATTIDDVVTEISAATVSER
FT                   GETRADDRTSVAAMEDRKREGYF"
     MSTVTDVVDE LRVLESEAVH IIREVVAELE RPVLLFSAGK DSIVLLRLAE KAFRPSPLPF        60
     PVLHVDTGHN FEEVIEFRDR RIKEGGHTLL VASVQDSIDQ GRVQESTETS GSRNRLQTRT       120
     LLDALEGGRF DAAFGGARRD EERARAKERV LSFRDEFGQW DPRAQRAEPW SLYNGRIRRG       180
     ESVRVFPLSN WTELDIWRYI AQEELELPPI YFAHERRVFE RDGMLLAASE FSTDAENAAA       240
     TTEWVRYRTV GDLTITGAVR SHATTIDDVV TEISAATVSE RGETRADDRT SVAAMEDRKR       300
     EGYF                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page