(data stored in ACNUC1104 zone)

EMBL: AP008957.DNAA

AP008957.DNAA        Location/Qualifiers
FT   CDS             768..2330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="RER_00010"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00010"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30709"
FT                   /db_xref="GOA:C0ZLE1"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZLE1"
FT                   /protein_id="BAH30709.1"
FT                   /translation="MNDDPNALARVWVDVVAELTSDDPGSNLPALSSKQKAFVRLVRPL
FT                   TLAQGFALLSVPSPFAQETIERDLREPILQALGRHLGGQVEGLGVRIALEDDADAPAEP
FT                   VEERTGSRQFESVNSSGAYRRRRFTEGDGEPSDSETAETEEVDDDREALASVHESWPSY
FT                   FTKPPATPSASGSGANSLNAKYTFDTFVIGSSNRFAHAAAVAIAEAPARAYNPLFIWGA
FT                   SGLGKTHLLHAAGHYAQRLFPGMRVKYVSTEEFTNDFINSLRDDRKVAFKRRYRETDVL
FT                   LVDDIQFIEGKEGIQEEFFHTFNTLHNANKQIVVSSDRPPKQLATLEERLRTRFEWGLI
FT                   TDVQPPELETRIAILSKKARMDRLEVPHDVLELIASRIERNIRELEGALIRVTAFASLN
FT                   RQPLDLTLAEVVLRDLMPDSSSLEINAATIMAVTAEYFNMSIDDLCGPGKARPLAQARQ
FT                   ISMYLCRELTDLSLPKIGQTFGRDHTTVMYADKKIRKEMTERRKVYDQVQELTARIKQR
FT                   SKR"
     MNDDPNALAR VWVDVVAELT SDDPGSNLPA LSSKQKAFVR LVRPLTLAQG FALLSVPSPF        60
     AQETIERDLR EPILQALGRH LGGQVEGLGV RIALEDDADA PAEPVEERTG SRQFESVNSS       120
     GAYRRRRFTE GDGEPSDSET AETEEVDDDR EALASVHESW PSYFTKPPAT PSASGSGANS       180
     LNAKYTFDTF VIGSSNRFAH AAAVAIAEAP ARAYNPLFIW GASGLGKTHL LHAAGHYAQR       240
     LFPGMRVKYV STEEFTNDFI NSLRDDRKVA FKRRYRETDV LLVDDIQFIE GKEGIQEEFF       300
     HTFNTLHNAN KQIVVSSDRP PKQLATLEER LRTRFEWGLI TDVQPPELET RIAILSKKAR       360
     MDRLEVPHDV LELIASRIER NIRELEGALI RVTAFASLNR QPLDLTLAEV VLRDLMPDSS       420
     SLEINAATIM AVTAEYFNMS IDDLCGPGKA RPLAQARQIS MYLCRELTDL SLPKIGQTFG       480
     RDHTTVMYAD KKIRKEMTER RKVYDQVQEL TARIKQRSKR                             520
//

If you have problems or comments...

PBIL Back to PBIL home page