(data stored in ACNUC1104 zone)

EMBL: AP008957.DNAX

AP008957.DNAX        Location/Qualifiers
FT   CDS             415714..417960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="RER_03760"
FT                   /product="DNA polymerase III gamma/tau subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03760"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31084"
FT                   /db_xref="GOA:C0ZN32"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN32"
FT                   /protein_id="BAH31084.1"
FT                   /translation="MALYRKYRPASFAEVVGQEHVTAPLSTALDTGRINHAYLFSGPRG
FT                   CGKTSSARILARSLNCEQGPTSTPCDVCDSCVSLGPGGTGNLDVTELDAASHGGVDDTR
FT                   ELRDKAFHAPAASRYRVFIIDEAHMVTAAGFNALLKIVEEPPEHLIFIFATTEPEKVLP
FT                   TIRSRTHHYPFRLLAPSTMRGLLEKICAQEGVPVEPAVYPLVIKAGGGSPRDSLSVLDQ
FT                   LLAGAGEEGVTYPRALSLLGVTDVALIDEAVDALSASDGAALFGTVDRVMDAGHDPRRF
FT                   ALDLLERLRDLILMQAVSDASERGLVDAPEAELVTMREQIQRVGPATLTRFAETVHAGL
FT                   SEMRGATAPRLLLEVMCARMLLPSASDTESAVLQRLERLEQGIPAAGVAAAAAPRAAAT
FT                   PAPTVPPLEPEIASKFQRPSQRKAEPEARPEPAAPAPAAPPVVEAPVVEPPVAAAPVVE
FT                   PPTVEIVEPPVAEAPVVEAPVVEAPVVEAPVAEAPIVEAPVVEPPAPAPVEAEELIGLA
FT                   EPEPDYEPEPEYEEPAAAEAAPVSAGPTVETLRESWNTLRNKVGERNKVLPAMLSAATV
FT                   HDVRGHVVVIAHGSPVLGARVTQPHNAAVICEVLAEMFGGTWQVEYQEGAPTAPAASSA
FT                   PKATEAASRPAAAPRFSRPSQERAAQQPKAPQSQRGDSDDIPPPEAPDYPEDPGPAPAP
FT                   EVDYEATPPPATPEDEDEMFAEAAEPADPTARRDPEDVAKELLKDVLGARRLES"
     MALYRKYRPA SFAEVVGQEH VTAPLSTALD TGRINHAYLF SGPRGCGKTS SARILARSLN        60
     CEQGPTSTPC DVCDSCVSLG PGGTGNLDVT ELDAASHGGV DDTRELRDKA FHAPAASRYR       120
     VFIIDEAHMV TAAGFNALLK IVEEPPEHLI FIFATTEPEK VLPTIRSRTH HYPFRLLAPS       180
     TMRGLLEKIC AQEGVPVEPA VYPLVIKAGG GSPRDSLSVL DQLLAGAGEE GVTYPRALSL       240
     LGVTDVALID EAVDALSASD GAALFGTVDR VMDAGHDPRR FALDLLERLR DLILMQAVSD       300
     ASERGLVDAP EAELVTMREQ IQRVGPATLT RFAETVHAGL SEMRGATAPR LLLEVMCARM       360
     LLPSASDTES AVLQRLERLE QGIPAAGVAA AAAPRAAATP APTVPPLEPE IASKFQRPSQ       420
     RKAEPEARPE PAAPAPAAPP VVEAPVVEPP VAAAPVVEPP TVEIVEPPVA EAPVVEAPVV       480
     EAPVVEAPVA EAPIVEAPVV EPPAPAPVEA EELIGLAEPE PDYEPEPEYE EPAAAEAAPV       540
     SAGPTVETLR ESWNTLRNKV GERNKVLPAM LSAATVHDVR GHVVVIAHGS PVLGARVTQP       600
     HNAAVICEVL AEMFGGTWQV EYQEGAPTAP AASSAPKATE AASRPAAAPR FSRPSQERAA       660
     QQPKAPQSQR GDSDDIPPPE APDYPEDPGP APAPEVDYEA TPPPATPEDE DEMFAEAAEP       720
     ADPTARRDPE DVAKELLKDV LGARRLES                                          748
//

If you have problems or comments...

PBIL Back to PBIL home page