(data stored in ACNUC1104 zone)

EMBL: AP008957.FADA

AP008957.FADA        Location/Qualifiers
FT   CDS             428499..429713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadA"
FT                   /locus_tag="RER_03800"
FT                   /product="putative acetyl-CoA acyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /note="protein synonym:3-ketoacyl-CoA thiolase"
FT                   /note="protein synonym:fatty oxidation complex beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03800"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31088"
FT                   /db_xref="GOA:C0ZN36"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN36"
FT                   /protein_id="BAH31088.1"
FT                   /translation="MTTEAFIYEAIRTPRGRGKKTGSLHSVKPISLVTGLIQELRVRFP
FT                   DLDEDRISDLILGVVTPVGDQGMDIARVAVNDAGLPDTVGGVQLNRFCASGLEAVNMAA
FT                   QKVRSGWDELVIAGGVESMSRVPMGSDGGPWALDPATNYDNYFVPQGVGADLIATIEGF
FT                   SRDDVDAYAVRSQDLAAKAWTGGYFAKSVVPVKDINGITILDNDEHMRPGTTAENLAGL
FT                   ASAFGVIGEIGGFDAVSLQKYHWVEKINHVHHGGNSSGIVDGAALVLVGSEQAGKDMGL
FT                   TPRARVVATATSGADSTIMLTGPTPASKKVLAAAGLTVDDIDLFEINEAFASVVLKFQK
FT                   DLNIPDEKLNVNGGAIAMGHPLGATGAMITGTMVDELERRGGKRALITLCIGGGMGVAT
FT                   IIERV"
     MTTEAFIYEA IRTPRGRGKK TGSLHSVKPI SLVTGLIQEL RVRFPDLDED RISDLILGVV        60
     TPVGDQGMDI ARVAVNDAGL PDTVGGVQLN RFCASGLEAV NMAAQKVRSG WDELVIAGGV       120
     ESMSRVPMGS DGGPWALDPA TNYDNYFVPQ GVGADLIATI EGFSRDDVDA YAVRSQDLAA       180
     KAWTGGYFAK SVVPVKDING ITILDNDEHM RPGTTAENLA GLASAFGVIG EIGGFDAVSL       240
     QKYHWVEKIN HVHHGGNSSG IVDGAALVLV GSEQAGKDMG LTPRARVVAT ATSGADSTIM       300
     LTGPTPASKK VLAAAGLTVD DIDLFEINEA FASVVLKFQK DLNIPDEKLN VNGGAIAMGH       360
     PLGATGAMIT GTMVDELERR GGKRALITLC IGGGMGVATI IERV                        404
//

If you have problems or comments...

PBIL Back to PBIL home page