(data stored in ACNUC1104 zone)

EMBL: AP008957.FADB

AP008957.FADB        Location/Qualifiers
FT   CDS             429759..431900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadB"
FT                   /locus_tag="RER_03810"
FT                   /product="fatty oxidation complex alpha subunit"
FT                   /note="multifunctional protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03810"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31089"
FT                   /db_xref="GOA:C0ZN37"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN37"
FT                   /protein_id="BAH31089.1"
FT                   /translation="MTDQNIINWDQDADGIVVLTINDPNQGANTMNDAYIASMKATVDR
FT                   LVAEKDSITGAVITSGKKTFFAGGDLKNMIKVGPEQAEEIYNHSVEIKADLRRLETLGK
FT                   PVVAAINGAALGGGLEIALATHHRIAADVKGVKIGLPEVTLGLLPGGGGVVRTVRMLGL
FT                   QNALMGVLLQGQQRGPVQAKEVGLIDEVVGSVEELVPAAKAWIKANPEGGVQPWDVKGY
FT                   KIPGGTPSTPAFAANLPAFPANLRKQLKGAPMPAPRAIMAAAVEGSQVDIDNALLIEAR
FT                   YFTSLVTGRVAKNMIQAFFFDLQSINGGGSRPAGIEKSTIKKVGVLGAGMMGAGIAYVS
FT                   AKAGFDVVLKDVSIEAANKGKAYAEGIEAKALSRGKTTQEKSDALLAKITPTADPADFA
FT                   GVDFVIEAVFESQELKHKVFQEIEDIVDPKALLGSNTSTLPITGLATGVKRQEDFIGIH
FT                   FFSPVDKMPLVEIIRGEKTSDETLARVFDYVQAIRKTPIVVNDSRGFFTSRVIGTFINE
FT                   AIGMLAEGVEPATIEQAGMQAGYPAAPLQLSDELNLTLMQKIRKESADAAKAEGKELPA
FT                   DPAGEVINTLVEKFDRKGKLGGAGFYDYAEGKRTGLWSGLRENFNSGTSDAPIQDLIDR
FT                   MLFIEAIETQKCFDENVLITTADANIGSIMGIGFPAWTGGVHQFIVGYEGGTAGFVARA
FT                   KELAAQYGPRFTPPASLGA"
     MTDQNIINWD QDADGIVVLT INDPNQGANT MNDAYIASMK ATVDRLVAEK DSITGAVITS        60
     GKKTFFAGGD LKNMIKVGPE QAEEIYNHSV EIKADLRRLE TLGKPVVAAI NGAALGGGLE       120
     IALATHHRIA ADVKGVKIGL PEVTLGLLPG GGGVVRTVRM LGLQNALMGV LLQGQQRGPV       180
     QAKEVGLIDE VVGSVEELVP AAKAWIKANP EGGVQPWDVK GYKIPGGTPS TPAFAANLPA       240
     FPANLRKQLK GAPMPAPRAI MAAAVEGSQV DIDNALLIEA RYFTSLVTGR VAKNMIQAFF       300
     FDLQSINGGG SRPAGIEKST IKKVGVLGAG MMGAGIAYVS AKAGFDVVLK DVSIEAANKG       360
     KAYAEGIEAK ALSRGKTTQE KSDALLAKIT PTADPADFAG VDFVIEAVFE SQELKHKVFQ       420
     EIEDIVDPKA LLGSNTSTLP ITGLATGVKR QEDFIGIHFF SPVDKMPLVE IIRGEKTSDE       480
     TLARVFDYVQ AIRKTPIVVN DSRGFFTSRV IGTFINEAIG MLAEGVEPAT IEQAGMQAGY       540
     PAAPLQLSDE LNLTLMQKIR KESADAAKAE GKELPADPAG EVINTLVEKF DRKGKLGGAG       600
     FYDYAEGKRT GLWSGLRENF NSGTSDAPIQ DLIDRMLFIE AIETQKCFDE NVLITTADAN       660
     IGSIMGIGFP AWTGGVHQFI VGYEGGTAGF VARAKELAAQ YGPRFTPPAS LGA              713
//

If you have problems or comments...

PBIL Back to PBIL home page