(data stored in ACNUC1104 zone)

EMBL: AP008957.GLTB

AP008957.GLTB        Location/Qualifiers
FT   CDS             62436..67034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltB"
FT                   /locus_tag="RER_00510"
FT                   /product="glutamate synthase large subunit"
FT                   /EC_number="1.4.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00510"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30759"
FT                   /db_xref="GOA:C0ZLJ1"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLJ1"
FT                   /protein_id="BAH30759.1"
FT                   /translation="MKQLPGPQGLYHPSNEHDSCGVAFVVDMHGRRSRDIVEKAITALV
FT                   NLEHRGAAGSEPNTGDGAGILLQVPDKFFRAVVDFALPAEGAYATGIAFLPQGDADAHE
FT                   AAAAVEKIVVEEGLKVLGWREVGTDDSSLGALARDAMPTFRQIFIGSEGDKYTGMDLER
FT                   RAYVVRKRTEHELGSEGAGKGGPGSETVYFPSLSGQTFVYKGMLTTPQLKGFYLDLQDD
FT                   RVESALGLVHSRFSTNTFPSWPLAHPFRRVAHNGEINTVTGNENWMRARESLIDSDVFG
FT                   GRENLDKIFPICTQGASDTARFDEVLEMLHLAGRSLPHAVLMMIPEAWEKHESMDPARR
FT                   AFYEYHSALMEPWDGPASVCFTDGTVIGAVLDRNGLRPSRLWITEDGLVVMASEVGVLP
FT                   IDPSTVVRKVRLQPGRMFLVDTAQGRVISDDELKSELAAEHPYQQWIDEGLIHMDDLPD
FT                   RPYTYMSHERVVLRQQLFGFTSEEVNLLVKPMALSGAEALGSMGTDTPIAVLSSRPRML
FT                   FDYFSQLFAQVTNPPLDAIREEVVTSLGATIGPEGDLLHPNADSCKQIALPQPILHNDD
FT                   LSKLVHVNDDGEFPGFRSVVIRGLYPVKEGGDGIRRALEGIKYQVSQAIEGGARIVVLS
FT                   DRESTEDYAPIPSLLLTSAVHHHLVREKSRTKVGLIVEAGDAREVHHMALLIGFGAAAV
FT                   NPYMAFETIDEFLQNKELEGLTLEKGIANYIKAAGKGVLKVMSKMGISTLASYTGAQLF
FT                   QVIGLSQELTDEYFTGLQSQLGGIGLDQIAADVEARHRIAYLDRPEERAHRELEVGGEY
FT                   QWRREGEYHLFNPDTVFKLQHATRTGQYEVFKEYTTMVNDQSERLAALRGLFDFNIGKR
FT                   PSISIDEVEPASEIVKRFSTGAMSYGSISAEAHETLAIAMNRLGARSNSGEGGEHPSRF
FT                   TPDENGDLRRSAIKQVASGRFGVTSHYLSNCTDIQIKMAQGAKPGEGGQLPAHKVYPWV
FT                   AEVRHSTPGVGLISPPPHHDIYSIEDLAQLIHDLKNANPQARIHVKLVSEVGVGTVAAG
FT                   VSKAHADVVLISGHDGGTGATPLTSVKHAGAPWELGLAETQQTLLLNGLRDRIVVQVDG
FT                   QLKTGRDVVVAALLGGEEFGFATAPLVVSGCIMMRVCHLDTCPVGVATQNPLLRQRFSG
FT                   KPEFVENFFMFIAEEVRELLAELGFRTLLEAVGQVDMLDTTRALDHWKGSKAGNLDLSP
FT                   ILTQVESAFMDQDLHCTGTQDHGLDKALDQQLIVSARNALDKGEAVSFESAITNVNRTV
FT                   GTMLGHEVTKAFGGEGLPEGTIDITFTGSAGNSFGAFVPSGMTLRLHGDANDFVGKGLS
FT                   GGRIVVRPPLDAAEGFVAEDNIIGGNVILFGATSGEALLRGVVGERFAVRNSGATAVVE
FT                   GVGDHGCEYMTGGKVVILGATGRNFGAGMSGGVAYIYNPDKAFEKNLNTELVDLEDLSG
FT                   DDFTWLKSVIERHRDETGSEVATRILGDWSQQVGHFAKVMPRDYKKVLLAIAAAEKDGK
FT                   NVDEAVMEAARG"
     MKQLPGPQGL YHPSNEHDSC GVAFVVDMHG RRSRDIVEKA ITALVNLEHR GAAGSEPNTG        60
     DGAGILLQVP DKFFRAVVDF ALPAEGAYAT GIAFLPQGDA DAHEAAAAVE KIVVEEGLKV       120
     LGWREVGTDD SSLGALARDA MPTFRQIFIG SEGDKYTGMD LERRAYVVRK RTEHELGSEG       180
     AGKGGPGSET VYFPSLSGQT FVYKGMLTTP QLKGFYLDLQ DDRVESALGL VHSRFSTNTF       240
     PSWPLAHPFR RVAHNGEINT VTGNENWMRA RESLIDSDVF GGRENLDKIF PICTQGASDT       300
     ARFDEVLEML HLAGRSLPHA VLMMIPEAWE KHESMDPARR AFYEYHSALM EPWDGPASVC       360
     FTDGTVIGAV LDRNGLRPSR LWITEDGLVV MASEVGVLPI DPSTVVRKVR LQPGRMFLVD       420
     TAQGRVISDD ELKSELAAEH PYQQWIDEGL IHMDDLPDRP YTYMSHERVV LRQQLFGFTS       480
     EEVNLLVKPM ALSGAEALGS MGTDTPIAVL SSRPRMLFDY FSQLFAQVTN PPLDAIREEV       540
     VTSLGATIGP EGDLLHPNAD SCKQIALPQP ILHNDDLSKL VHVNDDGEFP GFRSVVIRGL       600
     YPVKEGGDGI RRALEGIKYQ VSQAIEGGAR IVVLSDREST EDYAPIPSLL LTSAVHHHLV       660
     REKSRTKVGL IVEAGDAREV HHMALLIGFG AAAVNPYMAF ETIDEFLQNK ELEGLTLEKG       720
     IANYIKAAGK GVLKVMSKMG ISTLASYTGA QLFQVIGLSQ ELTDEYFTGL QSQLGGIGLD       780
     QIAADVEARH RIAYLDRPEE RAHRELEVGG EYQWRREGEY HLFNPDTVFK LQHATRTGQY       840
     EVFKEYTTMV NDQSERLAAL RGLFDFNIGK RPSISIDEVE PASEIVKRFS TGAMSYGSIS       900
     AEAHETLAIA MNRLGARSNS GEGGEHPSRF TPDENGDLRR SAIKQVASGR FGVTSHYLSN       960
     CTDIQIKMAQ GAKPGEGGQL PAHKVYPWVA EVRHSTPGVG LISPPPHHDI YSIEDLAQLI      1020
     HDLKNANPQA RIHVKLVSEV GVGTVAAGVS KAHADVVLIS GHDGGTGATP LTSVKHAGAP      1080
     WELGLAETQQ TLLLNGLRDR IVVQVDGQLK TGRDVVVAAL LGGEEFGFAT APLVVSGCIM      1140
     MRVCHLDTCP VGVATQNPLL RQRFSGKPEF VENFFMFIAE EVRELLAELG FRTLLEAVGQ      1200
     VDMLDTTRAL DHWKGSKAGN LDLSPILTQV ESAFMDQDLH CTGTQDHGLD KALDQQLIVS      1260
     ARNALDKGEA VSFESAITNV NRTVGTMLGH EVTKAFGGEG LPEGTIDITF TGSAGNSFGA      1320
     FVPSGMTLRL HGDANDFVGK GLSGGRIVVR PPLDAAEGFV AEDNIIGGNV ILFGATSGEA      1380
     LLRGVVGERF AVRNSGATAV VEGVGDHGCE YMTGGKVVIL GATGRNFGAG MSGGVAYIYN      1440
     PDKAFEKNLN TELVDLEDLS GDDFTWLKSV IERHRDETGS EVATRILGDW SQQVGHFAKV      1500
     MPRDYKKVLL AIAAAEKDGK NVDEAVMEAA RG                                    1532
//

If you have problems or comments...

PBIL Back to PBIL home page