(data stored in ACNUC1104 zone)

EMBL: AP008957.GNTK

AP008957.GNTK        Location/Qualifiers
FT   CDS             338085..338606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gntK"
FT                   /locus_tag="RER_02960"
FT                   /product="gluconokinase"
FT                   /EC_number="2.7.1.12"
FT                   /note="protein synonym:gluconate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02960"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31004"
FT                   /db_xref="GOA:C0ZM27"
FT                   /db_xref="InterPro:IPR006001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM27"
FT                   /protein_id="BAH31004.1"
FT                   /translation="MTVQVVVMGVAGAGKSTVAVGLATSLGADFVDGDDLHPESNVAKM
FT                   RSGTPLTDEDRVPWLDAIAAWLSGRADAGRTGVVACSALRKDYRDRLRPDGLDVQFVHL
FT                   DGEFETISARMRSRAGHFMPESLLISQFEALEPLTDDERGITLNVVSKPSTLVGEAVDY
FT                   IHTSQRSVTA"
     MTVQVVVMGV AGAGKSTVAV GLATSLGADF VDGDDLHPES NVAKMRSGTP LTDEDRVPWL        60
     DAIAAWLSGR ADAGRTGVVA CSALRKDYRD RLRPDGLDVQ FVHLDGEFET ISARMRSRAG       120
     HFMPESLLIS QFEALEPLTD DERGITLNVV SKPSTLVGEA VDYIHTSQRS VTA              173
//

If you have problems or comments...

PBIL Back to PBIL home page