(data stored in ACNUC1104 zone)

EMBL: AP008957.GYRA

AP008957.GYRA        Location/Qualifiers
FT   CDS             12251..14782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="RER_00100"
FT                   /product="DNA gyrase subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00100"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30718"
FT                   /db_xref="GOA:C0ZLF0"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLF0"
FT                   /protein_id="BAH30718.1"
FT                   /translation="MTDTTLPPDGPQHDRIEPVDIQQEMQNSYIDYAMSVIVGRALPDV
FT                   RDGLKPVHRRVLYAMYDNGYRPDRGYVKSARPVAETMGNYHPHGDSSIYDTLVRMAQPW
FT                   SLRYPLVDGQGNFGSRGNDGAAAMRYTECRLTPLAMEMLREIDHETVDFTPNYDGKTQE
FT                   PTVLPSRIPNLLINGSNGIAVGMATNIPPHNLREVAEAIYWALENFEADEEATLAAVME
FT                   RIKGPDFPTHGLIVGGQGIQDAYTTGRGSVRMRGVVEIEEDAKGRTTIVITELPYQVNP
FT                   DNLITSIAEQVRDAKIGGISDIHDESSDRVGMRIVVTVKRDAVAKVVLNNLYKHTQLQT
FT                   SFGCNMLSIVDGVPRTLRLDQMIRLYTTHQLEVIVRRTRYLLRKAQERAHILRGLVKAL
FT                   DALDEVIALIRASQTVDIARAGLMELLDVDEIQADAILGMQLRRLAALERQKIVDELAE
FT                   IELEIADLEDILARPERQRAIVRDELKEIVDKYGDDRRTRIIAADGDVNDEDLIAREDV
FT                   VVTITETGYAKRTKTDLYRSQKRGGKGVQGAGLKQDDIVSHFFVTSTHDWLLFFTTKGR
FT                   VYRAKAYELPEASRTARGQHVANLLAFQPDERIQSVIQIKTYEDAPYLVLATRNGLVKK
FT                   SKLTDFDSNRSGGIVAINLRGEDELVGAVLCSADDDLLLVSAQGQSIRFSATDEALRPM
FT                   GRATSGVQGMRFNGDDELLSLNVVREGTFLLVATSGGYSKRTGMEDYPVQGRGGKGVLT
FT                   IQYDKKRGTLVGALIVDDDDELYAITSGGGVIRTAAKQVRKAGRQTKGVRLMNLGEGDT
FT                   LLAIARNADEPEELAAETTDNADNADGAKES"
     MTDTTLPPDG PQHDRIEPVD IQQEMQNSYI DYAMSVIVGR ALPDVRDGLK PVHRRVLYAM        60
     YDNGYRPDRG YVKSARPVAE TMGNYHPHGD SSIYDTLVRM AQPWSLRYPL VDGQGNFGSR       120
     GNDGAAAMRY TECRLTPLAM EMLREIDHET VDFTPNYDGK TQEPTVLPSR IPNLLINGSN       180
     GIAVGMATNI PPHNLREVAE AIYWALENFE ADEEATLAAV MERIKGPDFP THGLIVGGQG       240
     IQDAYTTGRG SVRMRGVVEI EEDAKGRTTI VITELPYQVN PDNLITSIAE QVRDAKIGGI       300
     SDIHDESSDR VGMRIVVTVK RDAVAKVVLN NLYKHTQLQT SFGCNMLSIV DGVPRTLRLD       360
     QMIRLYTTHQ LEVIVRRTRY LLRKAQERAH ILRGLVKALD ALDEVIALIR ASQTVDIARA       420
     GLMELLDVDE IQADAILGMQ LRRLAALERQ KIVDELAEIE LEIADLEDIL ARPERQRAIV       480
     RDELKEIVDK YGDDRRTRII AADGDVNDED LIAREDVVVT ITETGYAKRT KTDLYRSQKR       540
     GGKGVQGAGL KQDDIVSHFF VTSTHDWLLF FTTKGRVYRA KAYELPEASR TARGQHVANL       600
     LAFQPDERIQ SVIQIKTYED APYLVLATRN GLVKKSKLTD FDSNRSGGIV AINLRGEDEL       660
     VGAVLCSADD DLLLVSAQGQ SIRFSATDEA LRPMGRATSG VQGMRFNGDD ELLSLNVVRE       720
     GTFLLVATSG GYSKRTGMED YPVQGRGGKG VLTIQYDKKR GTLVGALIVD DDDELYAITS       780
     GGGVIRTAAK QVRKAGRQTK GVRLMNLGEG DTLLAIARNA DEPEELAAET TDNADNADGA       840
     KES                                                                     843
//

If you have problems or comments...

PBIL Back to PBIL home page