(data stored in ACNUC1104 zone)

EMBL: AP008957.HOLB

AP008957.HOLB        Location/Qualifiers
FT   CDS             568857..570086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holB"
FT                   /locus_tag="RER_05140"
FT                   /product="putative DNA polymerase III delta' subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05140"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31222"
FT                   /db_xref="GOA:C0ZNH0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR015199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNH0"
FT                   /protein_id="BAH31222.1"
FT                   /translation="MSTEVAERGVFGRLVGQHDVEQSLRDAALSARGDSSGSEMTHAWL
FT                   FTGPPGSGRSVAALCFAAALQCTSDGAPGCGECHACTTTMGGTHGDVRRIIPDGLSISV
FT                   KGMREIVNIASRRPTTGRWQVIVVEDADRLTEGAANALLKVVEEPPDRTVILLCAPTTD
FT                   PEDMSVTLRSRCRHMPLVTPSVESIAQVLIDRDGLDPERARIAASISGGHVGRARRLAT
FT                   DESARDERQRSLRLAADAIGASTAYKAAENLVKSIEADTKAFYAELKEQELEELKVSLG
FT                   GGGTGKGTAGTLRGSAGLIKDLEARQKSRDTRARRDLLDRTLIDLAGMYRDALSYSLGS
FT                   TSTATHPDMARQAAELAARTSPEGLLKCIEAVLECREAVDFNVKLQWALDAMVASIGAA
FT                   FRPPFSRSGG"
     MSTEVAERGV FGRLVGQHDV EQSLRDAALS ARGDSSGSEM THAWLFTGPP GSGRSVAALC        60
     FAAALQCTSD GAPGCGECHA CTTTMGGTHG DVRRIIPDGL SISVKGMREI VNIASRRPTT       120
     GRWQVIVVED ADRLTEGAAN ALLKVVEEPP DRTVILLCAP TTDPEDMSVT LRSRCRHMPL       180
     VTPSVESIAQ VLIDRDGLDP ERARIAASIS GGHVGRARRL ATDESARDER QRSLRLAADA       240
     IGASTAYKAA ENLVKSIEAD TKAFYAELKE QELEELKVSL GGGGTGKGTA GTLRGSAGLI       300
     KDLEARQKSR DTRARRDLLD RTLIDLAGMY RDALSYSLGS TSTATHPDMA RQAAELAART       360
     SPEGLLKCIE AVLECREAVD FNVKLQWALD AMVASIGAAF RPPFSRSGG                   409
//

If you have problems or comments...

PBIL Back to PBIL home page