(data stored in ACNUC1104 zone)

EMBL: AP008957.MCE1A

AP008957.MCE1A       Location/Qualifiers
FT   CDS             complement(756470..757654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mce1A"
FT                   /locus_tag="RER_06770"
FT                   /product="putative Mce family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06770"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31385"
FT                   /db_xref="GOA:C0ZPQ7"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="InterPro:IPR024516"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPQ7"
FT                   /protein_id="BAH31385.1"
FT                   /translation="MIVTGTSRIALALRGLLAIVLLIVAYVFLFSRGTDTFSSTPQVSA
FT                   VVPASAGALRVGSSVQYRGVVVGSVADIEPGTTASTISLAIDEGAFEDIPSTSQVRLMP
FT                   RNIFGDFFVDLIQPDGLSRGPALAPGTELASDQSEVAVQLYQSISRIYSLVSSLDPADI
FT                   NVALTAVSDAMSGKGNQIGESLDSVHQALVGAQPVIDGLGDDLDDIATLADSLSTSAPD
FT                   MLAAFENSITTSKTVVEKSDGLAGLLRAGTSTGSAATSLIGDNRDRLITLVDDADSLTG
FT                   AITSRPDHITTFYNGLRNLTIKLPPALAHGPWLSTDLRLSVTDLYPYGKTDCPQYDGTR
FT                   GPNCPAAATAFGGTVGPVGSPAEQSLISAITQGGTALDTLVAGPVFRGTTVVGG"
     MIVTGTSRIA LALRGLLAIV LLIVAYVFLF SRGTDTFSST PQVSAVVPAS AGALRVGSSV        60
     QYRGVVVGSV ADIEPGTTAS TISLAIDEGA FEDIPSTSQV RLMPRNIFGD FFVDLIQPDG       120
     LSRGPALAPG TELASDQSEV AVQLYQSISR IYSLVSSLDP ADINVALTAV SDAMSGKGNQ       180
     IGESLDSVHQ ALVGAQPVID GLGDDLDDIA TLADSLSTSA PDMLAAFENS ITTSKTVVEK       240
     SDGLAGLLRA GTSTGSAATS LIGDNRDRLI TLVDDADSLT GAITSRPDHI TTFYNGLRNL       300
     TIKLPPALAH GPWLSTDLRL SVTDLYPYGK TDCPQYDGTR GPNCPAAATA FGGTVGPVGS       360
     PAEQSLISAI TQGGTALDTL VAGPVFRGTT VVGG                                   394
//

If you have problems or comments...

PBIL Back to PBIL home page