(data stored in ACNUC1104 zone)

EMBL: AP008957.MCE1B

AP008957.MCE1B       Location/Qualifiers
FT   CDS             complement(755463..756473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mce1B"
FT                   /locus_tag="RER_06760"
FT                   /product="putative Mce family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06760"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31384"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPQ6"
FT                   /protein_id="BAH31384.1"
FT                   /translation="MSVKKSLIRFGLFAALSILATVVVVSTLINPVSGSSSQYRAVFVN
FT                   ASGLVTGSDVQIAGVRVGRVDSVELVNNQAVVGFELESTQRIPTDGRAVVRYADLLGAR
FT                   TISIEPGQGELVAGNYLSPGATIPVEQTQPAIDLTDILGGFRPLFDALDPAEVNELAAQ
FT                   VVQVFQGQGSTIESLLERTVAVTENLTSRDAILDQLLTNLDRVLTVTTTNRPNFVEMIN
FT                   TLDTLVGGLAQDRQQISAAVDSAGALTSSLQDLVTRVEPDLAGALTSIDQSASVVVDNR
FT                   ESLATGITAFDQLFTQLGIAMSYGSWANIYICNFRLSALDQSVTLGGPERSAVCR"
     MSVKKSLIRF GLFAALSILA TVVVVSTLIN PVSGSSSQYR AVFVNASGLV TGSDVQIAGV        60
     RVGRVDSVEL VNNQAVVGFE LESTQRIPTD GRAVVRYADL LGARTISIEP GQGELVAGNY       120
     LSPGATIPVE QTQPAIDLTD ILGGFRPLFD ALDPAEVNEL AAQVVQVFQG QGSTIESLLE       180
     RTVAVTENLT SRDAILDQLL TNLDRVLTVT TTNRPNFVEM INTLDTLVGG LAQDRQQISA       240
     AVDSAGALTS SLQDLVTRVE PDLAGALTSI DQSASVVVDN RESLATGITA FDQLFTQLGI       300
     AMSYGSWANI YICNFRLSAL DQSVTLGGPE RSAVCR                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page