(data stored in ACNUC1104 zone)

EMBL: AP008957.MGTC

AP008957.MGTC        Location/Qualifiers
FT   CDS             666766..667470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mgtC"
FT                   /locus_tag="RER_05890"
FT                   /product="putative membrane protein MgtC"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05890"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31297"
FT                   /db_xref="GOA:C0ZNP5"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNP5"
FT                   /protein_id="BAH31297.1"
FT                   /translation="MEIHVILVRIALGLVLGAAVGIERQWRARMAGLRTNALVSLGATL
FT                   FVIMGAYGFQGPDADPTRVAAQIVSGIGFLGAGVIMKQGASVTGLNTAATLWATAAVGA
FT                   LAGGGMYWVAVFGAGAIMLANTLLRPLGRMMDHQPARTGREEPPADYTFEVTCHGDAEA
FT                   HIRGLTVQSISRPEFQLRSVQSFDIPDSDRVRVVAELAAAERDDGLLESAVSRLSLEPL
FT                   VTHVRWEVEPSK"
     MEIHVILVRI ALGLVLGAAV GIERQWRARM AGLRTNALVS LGATLFVIMG AYGFQGPDAD        60
     PTRVAAQIVS GIGFLGAGVI MKQGASVTGL NTAATLWATA AVGALAGGGM YWVAVFGAGA       120
     IMLANTLLRP LGRMMDHQPA RTGREEPPAD YTFEVTCHGD AEAHIRGLTV QSISRPEFQL       180
     RSVQSFDIPD SDRVRVVAEL AAAERDDGLL ESAVSRLSLE PLVTHVRWEV EPSK             234
//

If you have problems or comments...

PBIL Back to PBIL home page