(data stored in ACNUC1104 zone)

EMBL: AP008957.OTSB

AP008957.OTSB        Location/Qualifiers
FT   CDS             complement(783901..786393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="otsB"
FT                   /locus_tag="RER_07050"
FT                   /product="putative trehalose-phosphatase"
FT                   /EC_number="3.1.3.12"
FT                   /note="protein synonym:trehalose 6-phosphate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_07050"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31413"
FT                   /db_xref="GOA:C0ZPT5"
FT                   /db_xref="InterPro:IPR003337"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPT5"
FT                   /protein_id="BAH31413.1"
FT                   /translation="MARTPRLLVASDYDGTMAPIVANPDKAYPRAETVRALRSLASLAS
FT                   TTAAVISGRALKDLAALSRLPAEVQLVGSHGSEFDIGFVHAIDADARKLLDEIVTELGR
FT                   IAADTPGATVEKKPASVALHVRNTSADDAEKALIAVRTESALWPGVQVTEGKSVVELAV
FT                   IATDKGHALDLIRHQDGATAAVFIGDDVTDEKAFSRLQGPDIGIKVGSGDTVADYRVDS
FT                   TEDVAAALAFLLDERRTWLSGADAPPIERLSMLASPRTVALVTPDATLTWLCHPEPDSA
FT                   AVFAHLLGGTGAGHFSVGPRRTALPLSQKYIDSTMTVQTRWASLSVTDYLPHDVPQGRT
FT                   DLTRIISGQADAIVSFAPRPEFGQGQVTLEVVDEGIRVLGTNEPYVLRSPGVLWNIATD
FT                   GNQQTAHAIVEPSKGDVVLELRCGTEELGPSEVPELERRATSEAYWSDWAKTLELPKLK
FT                   PDLMKRSALTLRGLVHADSGSIMAAATTSLPEEIGGVRNWDYRYCWLRDAALTATALVS
FT                   VGSTDEAENYLDWVHRVLETLPGPERLHPLYTLYGTSLPPEAVIDSLPGYAGSRPVRVG
FT                   NAANQQVQLDVFGPIVELIVELANAREKAGAPDPLSDRDWELVCAMVEAVQRRWFEPDH
FT                   GIWEIRDNPRHHVYSKVMGWVTVDRAVDLATRFSREALPEWAELRDQIADEVRHKGWKD
FT                   DVQSYTAAYDGTDLDAATLHIGLSGLIDPTDPRFAATVVATEAELRSGSTVYRYHHDDG
FT                   LPGIEGGFHLCAAWLVEAYLLIGQRLQAEALFDQLVAAAGPTGLLAEEYDPIAERSLGN
FT                   HPQAYSHLGLLRCAQLLA"
     MARTPRLLVA SDYDGTMAPI VANPDKAYPR AETVRALRSL ASLASTTAAV ISGRALKDLA        60
     ALSRLPAEVQ LVGSHGSEFD IGFVHAIDAD ARKLLDEIVT ELGRIAADTP GATVEKKPAS       120
     VALHVRNTSA DDAEKALIAV RTESALWPGV QVTEGKSVVE LAVIATDKGH ALDLIRHQDG       180
     ATAAVFIGDD VTDEKAFSRL QGPDIGIKVG SGDTVADYRV DSTEDVAAAL AFLLDERRTW       240
     LSGADAPPIE RLSMLASPRT VALVTPDATL TWLCHPEPDS AAVFAHLLGG TGAGHFSVGP       300
     RRTALPLSQK YIDSTMTVQT RWASLSVTDY LPHDVPQGRT DLTRIISGQA DAIVSFAPRP       360
     EFGQGQVTLE VVDEGIRVLG TNEPYVLRSP GVLWNIATDG NQQTAHAIVE PSKGDVVLEL       420
     RCGTEELGPS EVPELERRAT SEAYWSDWAK TLELPKLKPD LMKRSALTLR GLVHADSGSI       480
     MAAATTSLPE EIGGVRNWDY RYCWLRDAAL TATALVSVGS TDEAENYLDW VHRVLETLPG       540
     PERLHPLYTL YGTSLPPEAV IDSLPGYAGS RPVRVGNAAN QQVQLDVFGP IVELIVELAN       600
     AREKAGAPDP LSDRDWELVC AMVEAVQRRW FEPDHGIWEI RDNPRHHVYS KVMGWVTVDR       660
     AVDLATRFSR EALPEWAELR DQIADEVRHK GWKDDVQSYT AAYDGTDLDA ATLHIGLSGL       720
     IDPTDPRFAA TVVATEAELR SGSTVYRYHH DDGLPGIEGG FHLCAAWLVE AYLLIGQRLQ       780
     AEALFDQLVA AAGPTGLLAE EYDPIAERSL GNHPQAYSHL GLLRCAQLLA                  830
//

If you have problems or comments...

PBIL Back to PBIL home page