(data stored in ACNUC1104 zone)

EMBL: AP008957.PANC

AP008957.PANC        Location/Qualifiers
FT   CDS             713236..714177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panC"
FT                   /locus_tag="RER_06330"
FT                   /product="pantothenate synthetase"
FT                   /EC_number="6.3.2.1"
FT                   /note="protein synonym:pantoate--beta-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06330"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31341"
FT                   /db_xref="GOA:C0ZPL3"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPL3"
FT                   /protein_id="BAH31341.1"
FT                   /translation="MTVVSDLQGGYKRGELTVHHDPDRLRRVSRALRGVGRQVALVPTM
FT                   GALHAGHIELVRQAKVTGAVVIVSIFVNPLQFGAGEDLDAYPRTLDADLDLLRAEGVEL
FT                   VFAPSAKTMYPRGQRTTIVPGPLGSELEGGARPTHFAGMLTVVAKLLQIAAPNHAYFGE
FT                   KDYQQLTLIRQMVWDLNFDVQIIGVPTVREFDGLALSSRNRYLDEGQRAAAVALSAALI
FT                   AGAHAASGGAEAILETARAVLAAVPEIEVDYLEVRGVDLGPAPERGDGRLLVAAKLGTT
FT                   RLIDNVGVAVGTGFLERDTDPSADAIDDLLSH"
     MTVVSDLQGG YKRGELTVHH DPDRLRRVSR ALRGVGRQVA LVPTMGALHA GHIELVRQAK        60
     VTGAVVIVSI FVNPLQFGAG EDLDAYPRTL DADLDLLRAE GVELVFAPSA KTMYPRGQRT       120
     TIVPGPLGSE LEGGARPTHF AGMLTVVAKL LQIAAPNHAY FGEKDYQQLT LIRQMVWDLN       180
     FDVQIIGVPT VREFDGLALS SRNRYLDEGQ RAAAVALSAA LIAGAHAASG GAEAILETAR       240
     AVLAAVPEIE VDYLEVRGVD LGPAPERGDG RLLVAAKLGT TRLIDNVGVA VGTGFLERDT       300
     DPSADAIDDL LSH                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page