(data stored in ACNUC1104 zone)

EMBL: AP008957.PE101

AP008957.PE101       Location/Qualifiers
FT   CDS             120276..121016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01010"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01010"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30809"
FT                   /db_xref="GOA:C0ZLB9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLB9"
FT                   /protein_id="BAH30809.1"
FT                   /translation="MTVTTGTTVLDIQNVDLTFPDGQSRVTALDDVSLRLHRGEIAAIT
FT                   GPSGSGKSSLLAVASTLIRPDSGHVYLRTPEGSTDIAALSRRAASELRRSSIGIVFQQS
FT                   NLVSSLTALEQLEVMAHLGQSVFTSRTRRKAVKSKAMDLLDAVGLADQSGKRPSQLSGG
FT                   QRQRVNLARALMNDPQLLVVDEPTSALDQERGAAVMDLIIGVVREHEAATLLVTHDRSH
FT                   LSRMDTVYRVVDGSLAEDQEALAA"
     MTVTTGTTVL DIQNVDLTFP DGQSRVTALD DVSLRLHRGE IAAITGPSGS GKSSLLAVAS        60
     TLIRPDSGHV YLRTPEGSTD IAALSRRAAS ELRRSSIGIV FQQSNLVSSL TALEQLEVMA       120
     HLGQSVFTSR TRRKAVKSKA MDLLDAVGLA DQSGKRPSQL SGGQRQRVNL ARALMNDPQL       180
     LVVDEPTSAL DQERGAAVMD LIIGVVREHE AATLLVTHDR SHLSRMDTVY RVVDGSLAED       240
     QEALAA                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page