(data stored in ACNUC1104 zone)

EMBL: AP008957.PE104

AP008957.PE104       Location/Qualifiers
FT   CDS             122253..123224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01040"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30812"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLC2"
FT                   /protein_id="BAH30812.1"
FT                   /translation="MTKVLVLGGYGAVGIPLMKQLAKVPEISAYSAGRDRARADVVVDL
FT                   KEPGAYSAAVRDFDVVVNASGFEDVRLAEEAVRGGAAFVDITATSNYCEELEAVDGPVL
FT                   MGVGLAPGLTSVLAAEAHRLGDGPVDIVIGLGGGELHGPAATAWTYGMLGTRFPDPDGR
FT                   SIRNYTGMKTFRMPADATGYRSGPAVRADFSDQHALTRDLGVPVRTYLRLDTSTATLGL
FT                   AAMTWAPALQKVVPKKLWGSDRWVAMARTDTGPALWVSGRSQSAATATIAARAVQVIRD
FT                   SAISKPTWFHAVETAESLQLAVPELSVRQWDGTRRTSGKAVD"
     MTKVLVLGGY GAVGIPLMKQ LAKVPEISAY SAGRDRARAD VVVDLKEPGA YSAAVRDFDV        60
     VVNASGFEDV RLAEEAVRGG AAFVDITATS NYCEELEAVD GPVLMGVGLA PGLTSVLAAE       120
     AHRLGDGPVD IVIGLGGGEL HGPAATAWTY GMLGTRFPDP DGRSIRNYTG MKTFRMPADA       180
     TGYRSGPAVR ADFSDQHALT RDLGVPVRTY LRLDTSTATL GLAAMTWAPA LQKVVPKKLW       240
     GSDRWVAMAR TDTGPALWVS GRSQSAATAT IAARAVQVIR DSAISKPTWF HAVETAESLQ       300
     LAVPELSVRQ WDGTRRTSGK AVD                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page