(data stored in ACNUC1104 zone)

EMBL: AP008957.PE108

AP008957.PE108       Location/Qualifiers
FT   CDS             complement(127217..128053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01080"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30816"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLC6"
FT                   /protein_id="BAH30816.1"
FT                   /translation="MRAPTRRSVYALADGHHPYPTPDGVWHYLTPDENAVTIGAPAEDL
FT                   AELDNFLRRSGSVLGPGAIEIADALVSRGVLAVPGQVPEIPAPQRVLMDGVGPVADACI
FT                   ALLSKALPDLEVVSTTAPIEDDVASSDLVLSVADAPPHDAWSELDTWCRHSRTPWQRVH
FT                   KELGEICIGPFFDGIDSASYRDVCGRRLAASRVPDHLLALWNHLADSERRPLGLSPTAA
FT                   AMVSALACSDVVAGAHGAPQSHLHHQIRMNPRTLMMTRHPVLPLPGGVLEPSPTLR"
     MRAPTRRSVY ALADGHHPYP TPDGVWHYLT PDENAVTIGA PAEDLAELDN FLRRSGSVLG        60
     PGAIEIADAL VSRGVLAVPG QVPEIPAPQR VLMDGVGPVA DACIALLSKA LPDLEVVSTT       120
     APIEDDVASS DLVLSVADAP PHDAWSELDT WCRHSRTPWQ RVHKELGEIC IGPFFDGIDS       180
     ASYRDVCGRR LAASRVPDHL LALWNHLADS ERRPLGLSPT AAAMVSALAC SDVVAGAHGA       240
     PQSHLHHQIR MNPRTLMMTR HPVLPLPGGV LEPSPTLR                               278
//

If you have problems or comments...

PBIL Back to PBIL home page