(data stored in ACNUC1104 zone)

EMBL: AP008957.PE110

AP008957.PE110       Location/Qualifiers
FT   CDS             128450..129664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01100"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01100"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30818"
FT                   /db_xref="GOA:C0ZLC8"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLC8"
FT                   /protein_id="BAH30818.1"
FT                   /translation="MFRDRSFRLFFTARTIAVAGAAVTGVAMPILVFDISRSPFLTSLA
FT                   AAGTVLPYLVFGLFAGAVADRVNRRTVILCAQAVAALALASIPAAQALGVLTAWHAVGV
FT                   SMCIGTCFVWFDAAAFGALPALVGRQRIPAANSALWTSSTLVDVAFPAIAGVLVASIGP
FT                   AYALGADALAYVLAGLAMASIGASFSSTPAVPKKSEPGIARDIREGLSFLWQSPLLRAL
FT                   TGVGFVNSLTQGAVTALLVVYATEGLGISTSSPMIGAVWTAVSVGGVVGAVLLPRLPAQ
FT                   WPVGAITVGALTIAPVVLFVVATTSNTAAAITALTVYSGCATVTILNGIGARQRLTPDR
FT                   LQGRVNTTARMVAWGGSPVGALIAGAIAGRWDIGTAYLVACSFALVGALFAWVSALRTD
FT                   PCPHR"
     MFRDRSFRLF FTARTIAVAG AAVTGVAMPI LVFDISRSPF LTSLAAAGTV LPYLVFGLFA        60
     GAVADRVNRR TVILCAQAVA ALALASIPAA QALGVLTAWH AVGVSMCIGT CFVWFDAAAF       120
     GALPALVGRQ RIPAANSALW TSSTLVDVAF PAIAGVLVAS IGPAYALGAD ALAYVLAGLA       180
     MASIGASFSS TPAVPKKSEP GIARDIREGL SFLWQSPLLR ALTGVGFVNS LTQGAVTALL       240
     VVYATEGLGI STSSPMIGAV WTAVSVGGVV GAVLLPRLPA QWPVGAITVG ALTIAPVVLF       300
     VVATTSNTAA AITALTVYSG CATVTILNGI GARQRLTPDR LQGRVNTTAR MVAWGGSPVG       360
     ALIAGAIAGR WDIGTAYLVA CSFALVGALF AWVSALRTDP CPHR                        404
//

If you have problems or comments...

PBIL Back to PBIL home page