(data stored in ACNUC1104 zone)

EMBL: AP008957.PE111

AP008957.PE111       Location/Qualifiers
FT   CDS             129749..130816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01110"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01110"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30819"
FT                   /db_xref="GOA:C0ZLC9"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLC9"
FT                   /protein_id="BAH30819.1"
FT                   /translation="MTLTSEAVPDAPSRAHPVGDRGYVPFLLATAVVLATVSTVAVWSG
FT                   AASLSFADVFAVLYAHVGGPPVDPLLDRIVWGLRVPRILIAALAGAGLSLAGAVLQALV
FT                   RNPIADPYILGVGSGASFGAVLIMTTGIGTGLSIGVPVAAFLGAMVSLIAVLVLGRREG
FT                   MLVPLRMVLAGVAIGYLLSAATSFVQLRADPSQLSGVLFWLLGSVSGAGWSDLGVPAAV
FT                   ITVCAAVLLTQSRQLNALAMGDESAQSVGVDVRRTRLLLLVIASLLTAVVVSVAGGIGF
FT                   VGLLVPHAVRLLVGSDHRKLLPATALVGATFLVIVDLAARMLDAPNELPLGIITAGLGA
FT                   PFFLWLLRRDGGAQS"
     MTLTSEAVPD APSRAHPVGD RGYVPFLLAT AVVLATVSTV AVWSGAASLS FADVFAVLYA        60
     HVGGPPVDPL LDRIVWGLRV PRILIAALAG AGLSLAGAVL QALVRNPIAD PYILGVGSGA       120
     SFGAVLIMTT GIGTGLSIGV PVAAFLGAMV SLIAVLVLGR REGMLVPLRM VLAGVAIGYL       180
     LSAATSFVQL RADPSQLSGV LFWLLGSVSG AGWSDLGVPA AVITVCAAVL LTQSRQLNAL       240
     AMGDESAQSV GVDVRRTRLL LLVIASLLTA VVVSVAGGIG FVGLLVPHAV RLLVGSDHRK       300
     LLPATALVGA TFLVIVDLAA RMLDAPNELP LGIITAGLGA PFFLWLLRRD GGAQS            355
//

If you have problems or comments...

PBIL Back to PBIL home page