(data stored in ACNUC1104 zone)

EMBL: AP008957.PE113

AP008957.PE113       Location/Qualifiers
FT   CDS             131604..132584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01130"
FT                   /product="putative ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01130"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30821"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLD1"
FT                   /protein_id="BAH30821.1"
FT                   /translation="MKSSIRTAALLCSAVTATAVLTACGNSTADSAASSSEKISVTNCD
FT                   REVTLPKTAERIVSLYPSMTELLIQLGAADRIVGQSNTDLSPPSPELADQFAEVPVLST
FT                   GVPAKEALLDARPDLIVSDGEYWFDGDRLQTMDELRDLGIPIFVNSGYCHKAVTEGRID
FT                   DVWSDLDGLGALTGTSDAAATLLADGKKSLAATEASVAGQEPVPAVMVQVSEGQSYALA
FT                   RGLYSSVLEAAGGSNLFENDLPDGKYFGQVATESVLAKSPKAVLVVYSTESARESTLDA
FT                   ARTAFAGTPAATSNAIFAVPEAWFAGELVSIDGAAEVSRLLHPGS"
     MKSSIRTAAL LCSAVTATAV LTACGNSTAD SAASSSEKIS VTNCDREVTL PKTAERIVSL        60
     YPSMTELLIQ LGAADRIVGQ SNTDLSPPSP ELADQFAEVP VLSTGVPAKE ALLDARPDLI       120
     VSDGEYWFDG DRLQTMDELR DLGIPIFVNS GYCHKAVTEG RIDDVWSDLD GLGALTGTSD       180
     AAATLLADGK KSLAATEASV AGQEPVPAVM VQVSEGQSYA LARGLYSSVL EAAGGSNLFE       240
     NDLPDGKYFG QVATESVLAK SPKAVLVVYS TESARESTLD AARTAFAGTP AATSNAIFAV       300
     PEAWFAGELV SIDGAAEVSR LLHPGS                                            326
//

If you have problems or comments...

PBIL Back to PBIL home page