(data stored in ACNUC1104 zone)

EMBL: AP008957.PE114

AP008957.PE114       Location/Qualifiers
FT   CDS             132589..133275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01140"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30822"
FT                   /db_xref="GOA:C0ZLD2"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR020051"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLD2"
FT                   /protein_id="BAH30822.1"
FT                   /translation="MTALERVEAVVSLHAALDRTVAPSELLFDEAALPPVTPEFVELPA
FT                   PTPLPARDFPDILQARRSHYNPAQVALGIGELSNVLHHSLVSSPTAGGMRELTLSFVVS
FT                   HPGHSLGAGVYRYIQEGRAEAVRPGDVQGNLRASLLQPEFVDVFPVLLFVVADVEAPLE
FT                   KYAMRHYRTMHVDAGVLVQNLYLVTEAMGLVGCAIAGFTDARVASLLNLATTQLPVMAF
FT                   ALGRPS"
     MTALERVEAV VSLHAALDRT VAPSELLFDE AALPPVTPEF VELPAPTPLP ARDFPDILQA        60
     RRSHYNPAQV ALGIGELSNV LHHSLVSSPT AGGMRELTLS FVVSHPGHSL GAGVYRYIQE       120
     GRAEAVRPGD VQGNLRASLL QPEFVDVFPV LLFVVADVEA PLEKYAMRHY RTMHVDAGVL       180
     VQNLYLVTEA MGLVGCAIAG FTDARVASLL NLATTQLPVM AFALGRPS                    228
//

If you have problems or comments...

PBIL Back to PBIL home page