(data stored in ACNUC1104 zone)

EMBL: AP008957.PE115

AP008957.PE115       Location/Qualifiers
FT   CDS             complement(133277..133570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01150"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30823"
FT                   /db_xref="InterPro:IPR018649"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLD3"
FT                   /protein_id="BAH30823.1"
FT                   /translation="MSFLRRAGRVAVASSIHGNVQRRQRTRWAAEDQARAAQVQPVPPI
FT                   PDLPPLPPQAAPAESEMSMDAKLEQLTKLGELKNAGVLTEAEFETQKARILG"
     MSFLRRAGRV AVASSIHGNV QRRQRTRWAA EDQARAAQVQ PVPPIPDLPP LPPQAAPAES        60
     EMSMDAKLEQ LTKLGELKNA GVLTEAEFET QKARILG                                 97
//

If you have problems or comments...

PBIL Back to PBIL home page