(data stored in ACNUC1104 zone)

EMBL: AP008957.PE118

AP008957.PE118       Location/Qualifiers
FT   CDS             complement(135738..136964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01180"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01180"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30826"
FT                   /db_xref="GOA:C0ZLD6"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLD6"
FT                   /protein_id="BAH30826.1"
FT                   /translation="MEDLTEVASRAVAAERDARSVRWHNPAAVRKAAASVRDSLDDERS
FT                   ALSRPSYSGLSPSPHMARQLELITTLQPPLPADAGISTAAQAEADAVAAVTTARIALRA
FT                   AHLAVLEARVAALDAGDTDTVAAAIRGYVPLNSGNPVVRHVQDLGSRIREEARHVVSGK
FT                   PRSIAFRLGLSLGMGLAYLAFIRLFQWDAKEDRLPYLALYALSGVVGSVVCTNALSFDA
FT                   GRVRAALSGGTRLWHVLVAKNAMMLLLVGSAGFLLSAILAWRSGSSADLVKACGQVLTM
FT                   ILLWLGVANVMSVALPLRAEPMTARRHDGTWKQFLLSFVISYGVGLIVNLMLYWRVWAK
FT                   TTLLEQMGGPWIPVLLLLASAAATWLLLTVLAVLLAEQPRFRRGLQREMVVYREKTNHP
FT                   QATIQHNSG"
     MEDLTEVASR AVAAERDARS VRWHNPAAVR KAAASVRDSL DDERSALSRP SYSGLSPSPH        60
     MARQLELITT LQPPLPADAG ISTAAQAEAD AVAAVTTARI ALRAAHLAVL EARVAALDAG       120
     DTDTVAAAIR GYVPLNSGNP VVRHVQDLGS RIREEARHVV SGKPRSIAFR LGLSLGMGLA       180
     YLAFIRLFQW DAKEDRLPYL ALYALSGVVG SVVCTNALSF DAGRVRAALS GGTRLWHVLV       240
     AKNAMMLLLV GSAGFLLSAI LAWRSGSSAD LVKACGQVLT MILLWLGVAN VMSVALPLRA       300
     EPMTARRHDG TWKQFLLSFV ISYGVGLIVN LMLYWRVWAK TTLLEQMGGP WIPVLLLLAS       360
     AAATWLLLTV LAVLLAEQPR FRRGLQREMV VYREKTNHPQ ATIQHNSG                    408
//

If you have problems or comments...

PBIL Back to PBIL home page