(data stored in ACNUC1104 zone)

EMBL: AP008957.PE119

AP008957.PE119       Location/Qualifiers
FT   CDS             137004..137591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_01190"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01190"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30827"
FT                   /db_xref="InterPro:IPR007061"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLD7"
FT                   /protein_id="BAH30827.1"
FT                   /translation="MTTNSEKEDLQRYLQAARDALVWKLDGLSEYDIRRPMTRTGTNLL
FT                   GLVKHMIGVELGYFGPTFGRRVPDLPAWLRSEELNVDMWARADESSADIVETYRRTWAF
FT                   ADATIEQHDLDAPGFVKHWPEDRRDVTLHRILVHVVTEIHRHAGHADIVRELIDGAAGM
FT                   KAGDNNLAPGDEAWWAEYNDRLETAAREAHHA"
     MTTNSEKEDL QRYLQAARDA LVWKLDGLSE YDIRRPMTRT GTNLLGLVKH MIGVELGYFG        60
     PTFGRRVPDL PAWLRSEELN VDMWARADES SADIVETYRR TWAFADATIE QHDLDAPGFV       120
     KHWPEDRRDV TLHRILVHVV TEIHRHAGHA DIVRELIDGA AGMKAGDNNL APGDEAWWAE       180
     YNDRLETAAR EAHHA                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page